BLASTX nr result
ID: Paeonia24_contig00023569
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00023569 (374 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006443361.1| hypothetical protein CICLE_v10021469mg [Citr... 59 5e-07 emb|CBI29919.3| unnamed protein product [Vitis vinifera] 59 5e-07 ref|XP_002282457.1| PREDICTED: thioredoxin-like 1-1, chloroplast... 59 5e-07 ref|XP_002325404.1| thioredoxin-like 7 family protein [Populus t... 59 5e-07 emb|CAN64807.1| hypothetical protein VITISV_007145 [Vitis vinifera] 59 7e-07 gb|AAA33400.1| thioredoxin [Lilium longiflorum] 59 9e-07 ref|XP_007030215.1| Atypical CYS HIS rich thioredoxin 4 [Theobro... 58 1e-06 ref|XP_006305501.1| hypothetical protein CARUB_v10009966mg [Caps... 57 3e-06 ref|NP_172333.1| atypical CYS HIS rich thioredoxin 4 [Arabidops... 57 3e-06 ref|NP_001117248.1| atypical CYS HIS rich thioredoxin 4 [Arabid... 57 3e-06 ref|NP_001077491.1| atypical CYS HIS rich thioredoxin 4 [Arabid... 57 3e-06 ref|XP_004493141.1| PREDICTED: thioredoxin-like 1-1, chloroplast... 56 6e-06 >ref|XP_006443361.1| hypothetical protein CICLE_v10021469mg [Citrus clementina] gi|568850755|ref|XP_006479063.1| PREDICTED: thioredoxin-like 1-1, chloroplastic-like [Citrus sinensis] gi|557545623|gb|ESR56601.1| hypothetical protein CICLE_v10021469mg [Citrus clementina] Length = 290 Score = 59.3 bits (142), Expect = 5e-07 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 3/54 (5%) Frame = +1 Query: 181 KILEEKELVALSANRDLDFNYTPKPQPVP---VHEEVLAAVADSISKPSLPIPL 333 K LEEKEL+AL+AN+DL FNYTPKPQP+P V E LA V S +LP+PL Sbjct: 217 KGLEEKELLALAANKDLSFNYTPKPQPMPAPAVEEVGLAEVPPPHSILNLPLPL 270 >emb|CBI29919.3| unnamed protein product [Vitis vinifera] Length = 309 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/53 (56%), Positives = 36/53 (67%), Gaps = 2/53 (3%) Frame = +1 Query: 181 KILEEKELVALSANRDLDFNYTPKPQPVPVHEEVL--AAVADSISKPSLPIPL 333 K LEEKEL+ALSAN+D FNY+PKP P P EE+ A A + S LP+PL Sbjct: 228 KGLEEKELLALSANKDFSFNYSPKPVPTPAQEEIAVEATSAAAFSNEELPLPL 280 >ref|XP_002282457.1| PREDICTED: thioredoxin-like 1-1, chloroplastic-like [Vitis vinifera] Length = 311 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/53 (56%), Positives = 36/53 (67%), Gaps = 2/53 (3%) Frame = +1 Query: 181 KILEEKELVALSANRDLDFNYTPKPQPVPVHEEVL--AAVADSISKPSLPIPL 333 K LEEKEL+ALSAN+D FNY+PKP P P EE+ A A + S LP+PL Sbjct: 230 KGLEEKELLALSANKDFSFNYSPKPVPTPAQEEIAVEATSAAAFSNEELPLPL 282 >ref|XP_002325404.1| thioredoxin-like 7 family protein [Populus trichocarpa] gi|222862279|gb|EEE99785.1| thioredoxin-like 7 family protein [Populus trichocarpa] Length = 295 Score = 59.3 bits (142), Expect = 5e-07 Identities = 34/64 (53%), Positives = 41/64 (64%), Gaps = 7/64 (10%) Frame = +1 Query: 181 KILEEKELVALSANRDLDFNYTPK---PQPVPVHEEVLAAVADSISKPSLPIPL----TR 339 K LEEKELVAL+AN+DL F YTPK P PVP EEV S S LP+PL ++ Sbjct: 221 KGLEEKELVALAANKDLSFTYTPKPVQPAPVPAEEEVAPTAGPSHSDRGLPLPLPITSSK 280 Query: 340 ASQD 351 ++QD Sbjct: 281 SAQD 284 >emb|CAN64807.1| hypothetical protein VITISV_007145 [Vitis vinifera] Length = 311 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/53 (56%), Positives = 36/53 (67%), Gaps = 2/53 (3%) Frame = +1 Query: 181 KILEEKELVALSANRDLDFNYTPKPQPVPVHEEVL--AAVADSISKPSLPIPL 333 K LEEKEL+ALSAN+D FNY+PKP P P EE+ A A + S LP+PL Sbjct: 230 KGLEEKELLALSANKDFSFNYSPKPVPTPAQEEIAVEATSAAAXSNXELPLPL 282 >gb|AAA33400.1| thioredoxin [Lilium longiflorum] Length = 262 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/60 (51%), Positives = 43/60 (71%), Gaps = 3/60 (5%) Frame = +1 Query: 181 KILEEKELVALSANRDLDFNYTPKPQPVPVHEEVLAAVADSISKPSLP---IPLTRASQD 351 K LEEKELVAL+ANR+L F+YTPKP+ PVH+ D++ KP+ P +PLTR +++ Sbjct: 201 KGLEEKELVALAANRELGFSYTPKPEHEPVHQ------PDALPKPARPSPKVPLTRDAEE 254 >ref|XP_007030215.1| Atypical CYS HIS rich thioredoxin 4 [Theobroma cacao] gi|508718820|gb|EOY10717.1| Atypical CYS HIS rich thioredoxin 4 [Theobroma cacao] Length = 294 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/58 (55%), Positives = 40/58 (68%), Gaps = 6/58 (10%) Frame = +1 Query: 181 KILEEKELVALSANRDLDFNYTPK---PQPVPVHEEVLAA---VADSISKPSLPIPLT 336 K LEEKEL+AL+AN+DL FNYTPK P PVP EE+L + +DS +K P+P T Sbjct: 220 KGLEEKELLALAANKDLSFNYTPKPVQPSPVPAQEEILVSKEVPSDSGTKLPFPLPTT 277 >ref|XP_006305501.1| hypothetical protein CARUB_v10009966mg [Capsella rubella] gi|482574212|gb|EOA38399.1| hypothetical protein CARUB_v10009966mg [Capsella rubella] Length = 279 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/51 (62%), Positives = 38/51 (74%) Frame = +1 Query: 181 KILEEKELVALSANRDLDFNYTPKPQPVPVHEEVLAAVADSISKPSLPIPL 333 K LEEKELVAL+AN++L+FNYTPK PVPV +E A S PSLP+PL Sbjct: 219 KGLEEKELVALAANKELNFNYTPK--PVPVEKE----AATPNSNPSLPVPL 263 >ref|NP_172333.1| atypical CYS HIS rich thioredoxin 4 [Arabidopsis thaliana] gi|51701910|sp|O64654.1|TRL11_ARATH RecName: Full=Thioredoxin-like 1-1, chloroplastic; AltName: Full=Atypical cysteine/histidine-rich thioredoxin 4; Short=AtACHT4; AltName: Full=Lilium-type thioredoxin 1-1; Flags: Precursor gi|4973256|gb|AAD35005.1|AF144387_1 thioredoxin-like 1 [Arabidopsis thaliana] gi|9802552|gb|AAF99754.1|AC003981_4 F22O13.5 [Arabidopsis thaliana] gi|14334494|gb|AAK59444.1| putative thioredoxin [Arabidopsis thaliana] gi|17104801|gb|AAL34289.1| putative thioredoxin [Arabidopsis thaliana] gi|332190186|gb|AEE28307.1| atypical CYS HIS rich thioredoxin 4 [Arabidopsis thaliana] Length = 275 Score = 56.6 bits (135), Expect = 3e-06 Identities = 34/57 (59%), Positives = 41/57 (71%) Frame = +1 Query: 181 KILEEKELVALSANRDLDFNYTPKPQPVPVHEEVLAAVADSISKPSLPIPLTRASQD 351 K LEEKELVAL+AN++L+F YTPK PVPV +E AA D S PSLP+PL S + Sbjct: 215 KGLEEKELVALAANKELNFTYTPK--PVPVEKE--AATPD--SNPSLPVPLPSMSSN 265 >ref|NP_001117248.1| atypical CYS HIS rich thioredoxin 4 [Arabidopsis thaliana] gi|186478272|ref|NP_001117249.1| atypical CYS HIS rich thioredoxin 4 [Arabidopsis thaliana] gi|227202606|dbj|BAH56776.1| AT1G08570 [Arabidopsis thaliana] gi|332190188|gb|AEE28309.1| atypical CYS HIS rich thioredoxin 4 [Arabidopsis thaliana] gi|332190189|gb|AEE28310.1| atypical CYS HIS rich thioredoxin 4 [Arabidopsis thaliana] Length = 177 Score = 56.6 bits (135), Expect = 3e-06 Identities = 34/57 (59%), Positives = 41/57 (71%) Frame = +1 Query: 181 KILEEKELVALSANRDLDFNYTPKPQPVPVHEEVLAAVADSISKPSLPIPLTRASQD 351 K LEEKELVAL+AN++L+F YTPK PVPV +E AA D S PSLP+PL S + Sbjct: 117 KGLEEKELVALAANKELNFTYTPK--PVPVEKE--AATPD--SNPSLPVPLPSMSSN 167 >ref|NP_001077491.1| atypical CYS HIS rich thioredoxin 4 [Arabidopsis thaliana] gi|332190187|gb|AEE28308.1| atypical CYS HIS rich thioredoxin 4 [Arabidopsis thaliana] Length = 244 Score = 56.6 bits (135), Expect = 3e-06 Identities = 34/57 (59%), Positives = 41/57 (71%) Frame = +1 Query: 181 KILEEKELVALSANRDLDFNYTPKPQPVPVHEEVLAAVADSISKPSLPIPLTRASQD 351 K LEEKELVAL+AN++L+F YTPK PVPV +E AA D S PSLP+PL S + Sbjct: 184 KGLEEKELVALAANKELNFTYTPK--PVPVEKE--AATPD--SNPSLPVPLPSMSSN 234 >ref|XP_004493141.1| PREDICTED: thioredoxin-like 1-1, chloroplastic-like [Cicer arietinum] Length = 297 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/60 (50%), Positives = 39/60 (65%), Gaps = 3/60 (5%) Frame = +1 Query: 181 KILEEKELVALSANRDLDFNYTPKP-QPV--PVHEEVLAAVADSISKPSLPIPLTRASQD 351 K LEEKEL+ALS N+DL+F YTPKP QPV P +EE+ A + LP+P ++ D Sbjct: 225 KGLEEKELIALSENKDLNFTYTPKPLQPVHTPANEELATTKASPVCSEPLPLPSLTSNSD 284