BLASTX nr result
ID: Paeonia24_contig00022745
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00022745 (235 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003536456.1| PREDICTED: U3 small nucleolar ribonucleoprot... 82 8e-14 ref|XP_007143450.1| hypothetical protein PHAVU_007G072900g [Phas... 82 1e-13 ref|XP_004304195.1| PREDICTED: U3 small nucleolar ribonucleoprot... 81 1e-13 ref|XP_007215052.1| hypothetical protein PRUPE_ppa012139mg [Prun... 81 1e-13 gb|AFK41984.1| unknown [Lotus japonicus] 81 1e-13 gb|AFK40090.1| unknown [Lotus japonicus] 81 1e-13 ref|XP_006858645.1| hypothetical protein AMTR_s00066p00053070 [A... 79 5e-13 gb|AFK45487.1| unknown [Lotus japonicus] 79 5e-13 gb|EXB77643.1| U3 small nucleolar ribonucleoprotein [Morus notab... 78 1e-12 ref|XP_004503484.1| PREDICTED: U3 small nucleolar ribonucleoprot... 78 1e-12 ref|XP_002281732.1| PREDICTED: U3 small nucleolar ribonucleoprot... 78 1e-12 ref|XP_006338328.1| PREDICTED: U3 small nucleolar ribonucleoprot... 78 1e-12 ref|XP_003630716.1| U3 small nucleolar ribonucleoprotein IMP3 [M... 78 1e-12 ref|XP_003630715.1| U3 small nucleolar ribonucleoprotein IMP3 [M... 78 1e-12 ref|XP_003630714.1| U3 small nucleolar ribonucleoprotein IMP3 [M... 78 1e-12 ref|XP_006482441.1| PREDICTED: U3 small nucleolar ribonucleoprot... 77 2e-12 ref|XP_006430963.1| hypothetical protein CICLE_v10012892mg [Citr... 77 2e-12 ref|XP_006430962.1| hypothetical protein CICLE_v10012892mg [Citr... 77 2e-12 ref|XP_003063878.1| predicted protein [Micromonas pusilla CCMP15... 77 2e-12 ref|XP_002525943.1| U3 small nucleolar ribonucleoprotein protein... 77 2e-12 >ref|XP_003536456.1| PREDICTED: U3 small nucleolar ribonucleoprotein protein IMP3-like [Glycine max] gi|356575988|ref|XP_003556117.1| PREDICTED: U3 small nucleolar ribonucleoprotein protein IMP3-like [Glycine max] gi|255637789|gb|ACU19216.1| unknown [Glycine max] Length = 182 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -3 Query: 233 VTDPAFLVTRNLEDFVTWVDSSKIRRKVDTYNDKLDDYDLMN 108 VTDPAFLVTRN+EDFVTWVDSSKI+RKV YNDKLDDYDLMN Sbjct: 141 VTDPAFLVTRNMEDFVTWVDSSKIKRKVLQYNDKLDDYDLMN 182 >ref|XP_007143450.1| hypothetical protein PHAVU_007G072900g [Phaseolus vulgaris] gi|561016640|gb|ESW15444.1| hypothetical protein PHAVU_007G072900g [Phaseolus vulgaris] Length = 182 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -3 Query: 233 VTDPAFLVTRNLEDFVTWVDSSKIRRKVDTYNDKLDDYDLMN 108 VTDPAFLVTRN+EDF+TWVDSSKI+RKV YNDKLDDYDLMN Sbjct: 141 VTDPAFLVTRNMEDFITWVDSSKIKRKVLQYNDKLDDYDLMN 182 >ref|XP_004304195.1| PREDICTED: U3 small nucleolar ribonucleoprotein protein IMP3-like [Fragaria vesca subsp. vesca] Length = 182 Score = 81.3 bits (199), Expect = 1e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -3 Query: 233 VTDPAFLVTRNLEDFVTWVDSSKIRRKVDTYNDKLDDYDLMN 108 VTDPAFLVTRN+EDF+TWVDSSKI+RKV YNDKLDDYD+MN Sbjct: 141 VTDPAFLVTRNMEDFITWVDSSKIKRKVMQYNDKLDDYDIMN 182 >ref|XP_007215052.1| hypothetical protein PRUPE_ppa012139mg [Prunus persica] gi|462411202|gb|EMJ16251.1| hypothetical protein PRUPE_ppa012139mg [Prunus persica] Length = 182 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -3 Query: 233 VTDPAFLVTRNLEDFVTWVDSSKIRRKVDTYNDKLDDYDLMN 108 VTDPAFLVTRN+EDFVTWVDSSKIRRKV YNDKLDDYD MN Sbjct: 141 VTDPAFLVTRNMEDFVTWVDSSKIRRKVLEYNDKLDDYDAMN 182 >gb|AFK41984.1| unknown [Lotus japonicus] Length = 151 Score = 81.3 bits (199), Expect = 1e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -3 Query: 233 VTDPAFLVTRNLEDFVTWVDSSKIRRKVDTYNDKLDDYDLMN 108 VTDPAFLVTRN+EDFVTWVDSSKI+RKV YNDKLDDYD+MN Sbjct: 110 VTDPAFLVTRNMEDFVTWVDSSKIKRKVLKYNDKLDDYDIMN 151 >gb|AFK40090.1| unknown [Lotus japonicus] Length = 182 Score = 81.3 bits (199), Expect = 1e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -3 Query: 233 VTDPAFLVTRNLEDFVTWVDSSKIRRKVDTYNDKLDDYDLMN 108 VTDPAFLVTRN+EDFVTWVDSSKI+RKV YNDKLDDYD+MN Sbjct: 141 VTDPAFLVTRNMEDFVTWVDSSKIKRKVLKYNDKLDDYDIMN 182 >ref|XP_006858645.1| hypothetical protein AMTR_s00066p00053070 [Amborella trichopoda] gi|548862756|gb|ERN20112.1| hypothetical protein AMTR_s00066p00053070 [Amborella trichopoda] Length = 182 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -3 Query: 233 VTDPAFLVTRNLEDFVTWVDSSKIRRKVDTYNDKLDDYDLMN 108 VTDPAFLVTRN+EDFVTWVD+SKIRRKV YN+KLDDYDL+N Sbjct: 141 VTDPAFLVTRNMEDFVTWVDTSKIRRKVLQYNEKLDDYDLLN 182 >gb|AFK45487.1| unknown [Lotus japonicus] Length = 182 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -3 Query: 233 VTDPAFLVTRNLEDFVTWVDSSKIRRKVDTYNDKLDDYDLMN 108 VTDPAFLVTRN+EDFV WVDSSKI+RKV YNDKLDDYD+MN Sbjct: 141 VTDPAFLVTRNMEDFVAWVDSSKIKRKVLKYNDKLDDYDIMN 182 >gb|EXB77643.1| U3 small nucleolar ribonucleoprotein [Morus notabilis] Length = 223 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -3 Query: 233 VTDPAFLVTRNLEDFVTWVDSSKIRRKVDTYNDKLDDYDLMN 108 VTDPAFLVTRN+EDF+TWVDSSKI+RKV YND+LDDYD MN Sbjct: 182 VTDPAFLVTRNMEDFITWVDSSKIKRKVLEYNDQLDDYDAMN 223 >ref|XP_004503484.1| PREDICTED: U3 small nucleolar ribonucleoprotein protein IMP3-like [Cicer arietinum] Length = 182 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -3 Query: 233 VTDPAFLVTRNLEDFVTWVDSSKIRRKVDTYNDKLDDYDLMN 108 +TDPA+LVTRN+EDF+ WVDSSKI+RKV YNDKLDDYDLMN Sbjct: 141 ITDPAYLVTRNMEDFIAWVDSSKIKRKVLEYNDKLDDYDLMN 182 >ref|XP_002281732.1| PREDICTED: U3 small nucleolar ribonucleoprotein protein IMP3 [Vitis vinifera] gi|298204446|emb|CBI16926.3| unnamed protein product [Vitis vinifera] Length = 182 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -3 Query: 233 VTDPAFLVTRNLEDFVTWVDSSKIRRKVDTYNDKLDDYDLMN 108 VTDPAFLVTRNLEDFVTWVDSSKI+RKV YN++LDDYD MN Sbjct: 141 VTDPAFLVTRNLEDFVTWVDSSKIKRKVLQYNERLDDYDAMN 182 >ref|XP_006338328.1| PREDICTED: U3 small nucleolar ribonucleoprotein protein IMP3-like [Solanum tuberosum] Length = 182 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -3 Query: 233 VTDPAFLVTRNLEDFVTWVDSSKIRRKVDTYNDKLDDYDLMN 108 V DPAFLVTRN+EDF+TWVD+SKIRRKV YNDKLDDYD MN Sbjct: 141 VVDPAFLVTRNMEDFITWVDTSKIRRKVLEYNDKLDDYDAMN 182 >ref|XP_003630716.1| U3 small nucleolar ribonucleoprotein IMP3 [Medicago truncatula] gi|355524738|gb|AET05192.1| U3 small nucleolar ribonucleoprotein IMP3 [Medicago truncatula] Length = 173 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -3 Query: 233 VTDPAFLVTRNLEDFVTWVDSSKIRRKVDTYNDKLDDYDLMN 108 +TDPA+LVTRN+ED +TWVDSSKI+RKV YNDKLDDYDLMN Sbjct: 132 ITDPAYLVTRNMEDLITWVDSSKIKRKVLQYNDKLDDYDLMN 173 >ref|XP_003630715.1| U3 small nucleolar ribonucleoprotein IMP3 [Medicago truncatula] gi|355524737|gb|AET05191.1| U3 small nucleolar ribonucleoprotein IMP3 [Medicago truncatula] Length = 153 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -3 Query: 233 VTDPAFLVTRNLEDFVTWVDSSKIRRKVDTYNDKLDDYDLMN 108 +TDPA+LVTRN+ED +TWVDSSKI+RKV YNDKLDDYDLMN Sbjct: 112 ITDPAYLVTRNMEDLITWVDSSKIKRKVLQYNDKLDDYDLMN 153 >ref|XP_003630714.1| U3 small nucleolar ribonucleoprotein IMP3 [Medicago truncatula] gi|217075252|gb|ACJ85986.1| unknown [Medicago truncatula] gi|355524736|gb|AET05190.1| U3 small nucleolar ribonucleoprotein IMP3 [Medicago truncatula] gi|388502894|gb|AFK39513.1| unknown [Medicago truncatula] Length = 182 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -3 Query: 233 VTDPAFLVTRNLEDFVTWVDSSKIRRKVDTYNDKLDDYDLMN 108 +TDPA+LVTRN+ED +TWVDSSKI+RKV YNDKLDDYDLMN Sbjct: 141 ITDPAYLVTRNMEDLITWVDSSKIKRKVLQYNDKLDDYDLMN 182 >ref|XP_006482441.1| PREDICTED: U3 small nucleolar ribonucleoprotein protein IMP3-like [Citrus sinensis] Length = 182 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -3 Query: 233 VTDPAFLVTRNLEDFVTWVDSSKIRRKVDTYNDKLDDYDLMN 108 VTDPAFLVTRN+EDF+TWVD+SKI+RKV YNDK+DDYD MN Sbjct: 141 VTDPAFLVTRNMEDFITWVDTSKIKRKVLEYNDKVDDYDAMN 182 >ref|XP_006430963.1| hypothetical protein CICLE_v10012892mg [Citrus clementina] gi|557533020|gb|ESR44203.1| hypothetical protein CICLE_v10012892mg [Citrus clementina] Length = 182 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -3 Query: 233 VTDPAFLVTRNLEDFVTWVDSSKIRRKVDTYNDKLDDYDLMN 108 VTDPAFLVTRN+EDF+TWVD+SKI+RKV YNDK+DDYD MN Sbjct: 141 VTDPAFLVTRNMEDFITWVDTSKIKRKVLEYNDKVDDYDAMN 182 >ref|XP_006430962.1| hypothetical protein CICLE_v10012892mg [Citrus clementina] gi|557533019|gb|ESR44202.1| hypothetical protein CICLE_v10012892mg [Citrus clementina] Length = 154 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -3 Query: 233 VTDPAFLVTRNLEDFVTWVDSSKIRRKVDTYNDKLDDYDLMN 108 VTDPAFLVTRN+EDF+TWVD+SKI+RKV YNDK+DDYD MN Sbjct: 113 VTDPAFLVTRNMEDFITWVDTSKIKRKVLEYNDKVDDYDAMN 154 >ref|XP_003063878.1| predicted protein [Micromonas pusilla CCMP1545] gi|226454946|gb|EEH52251.1| predicted protein [Micromonas pusilla CCMP1545] Length = 181 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -3 Query: 233 VTDPAFLVTRNLEDFVTWVDSSKIRRKVDTYNDKLDDYDLM 111 VTDPAF VTRNLEDFVTWVD+SKI+RKV YNDKLDDYDL+ Sbjct: 141 VTDPAFCVTRNLEDFVTWVDTSKIKRKVAAYNDKLDDYDLL 181 >ref|XP_002525943.1| U3 small nucleolar ribonucleoprotein protein IMP3, putative [Ricinus communis] gi|223534772|gb|EEF36463.1| U3 small nucleolar ribonucleoprotein protein IMP3, putative [Ricinus communis] Length = 182 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -3 Query: 233 VTDPAFLVTRNLEDFVTWVDSSKIRRKVDTYNDKLDDYDLMN 108 VTDPAFLVTRN+EDFVTWVD+SKI+RKV YN+KLDDYD MN Sbjct: 141 VTDPAFLVTRNMEDFVTWVDTSKIKRKVLEYNEKLDDYDAMN 182