BLASTX nr result
ID: Paeonia24_contig00022719
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00022719 (415 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015750.1| F-box and associated interaction domains-con... 58 2e-06 ref|XP_007011152.1| F-box and associated interaction domains-con... 58 2e-06 ref|XP_007011141.1| F-box and associated interaction domains-con... 58 2e-06 ref|XP_007011137.1| F-box and associated interaction domains-con... 56 6e-06 ref|XP_007011146.1| F-box and associated interaction domains-con... 55 8e-06 ref|XP_007011145.1| F-box and associated interaction domains-con... 55 8e-06 >ref|XP_007015750.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|590586605|ref|XP_007015751.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786113|gb|EOY33369.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786114|gb|EOY33370.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] Length = 387 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/71 (42%), Positives = 43/71 (60%), Gaps = 1/71 (1%) Frame = +1 Query: 4 SWKKLYRIGPLYGFGEPLGFSKNGELFIQL-HKPLVLWDPVTLQIKCLQVEAEYRTLMVC 180 SW + + I + G PLGF KNGELF++ + LVL+DP T ++K L + A T+ + Sbjct: 297 SWTRQFSIESVSGVERPLGFWKNGELFLESSNHELVLFDPATRELKNLGIHAYQNTMQLI 356 Query: 181 LYTESLVSLKG 213 Y ESLV + G Sbjct: 357 AYVESLVPING 367 >ref|XP_007011152.1| F-box and associated interaction domains-containing protein [Theobroma cacao] gi|508728065|gb|EOY19962.1| F-box and associated interaction domains-containing protein [Theobroma cacao] Length = 686 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/72 (38%), Positives = 44/72 (61%), Gaps = 1/72 (1%) Frame = +1 Query: 7 WKKLYRIGPLYGFGEPLGFSKNGELFIQL-HKPLVLWDPVTLQIKCLQVEAEYRTLMVCL 183 W K IGP+ G G PLGF KNGELF++ + LV++DP T +++ + + + + Sbjct: 312 WTKQLTIGPILGVGRPLGFWKNGELFLESENHDLVMFDPCTGELQDFGIHMPMCSTQLVV 371 Query: 184 YTESLVSLKGGN 219 Y ES+V +KG + Sbjct: 372 YAESIVPIKGSS 383 >ref|XP_007011141.1| F-box and associated interaction domains-containing protein [Theobroma cacao] gi|508728054|gb|EOY19951.1| F-box and associated interaction domains-containing protein [Theobroma cacao] Length = 460 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/72 (38%), Positives = 44/72 (61%), Gaps = 1/72 (1%) Frame = +1 Query: 7 WKKLYRIGPLYGFGEPLGFSKNGELFIQL-HKPLVLWDPVTLQIKCLQVEAEYRTLMVCL 183 W K IGP+ G G PLGF KNGELF++ + LV++DP T +++ + + + + Sbjct: 207 WTKQLTIGPILGVGRPLGFWKNGELFLERENHDLVMFDPCTGELQDFGIHMPMCSTQLVV 266 Query: 184 YTESLVSLKGGN 219 Y ES+V +KG + Sbjct: 267 YAESIVPIKGSS 278 >ref|XP_007011137.1| F-box and associated interaction domains-containing protein [Theobroma cacao] gi|508728050|gb|EOY19947.1| F-box and associated interaction domains-containing protein [Theobroma cacao] Length = 548 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/72 (38%), Positives = 43/72 (59%), Gaps = 1/72 (1%) Frame = +1 Query: 7 WKKLYRIGPLYGFGEPLGFSKNGELFIQL-HKPLVLWDPVTLQIKCLQVEAEYRTLMVCL 183 W K IGP+ G G PLGF KNGELF++ + LV++DP T +++ + + + Sbjct: 279 WTKQLTIGPILGVGRPLGFWKNGELFLESENHDLVMFDPCTGKLQDFGIHMPKCGTQLVV 338 Query: 184 YTESLVSLKGGN 219 Y ES+V +KG + Sbjct: 339 YAESIVPIKGSS 350 >ref|XP_007011146.1| F-box and associated interaction domains-containing protein isoform 2 [Theobroma cacao] gi|508728059|gb|EOY19956.1| F-box and associated interaction domains-containing protein isoform 2 [Theobroma cacao] Length = 400 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/73 (43%), Positives = 47/73 (64%), Gaps = 3/73 (4%) Frame = +1 Query: 4 SWKKLYRIGPLYGFGEPLGFSKNGELFIQL--HKPLVLWDPVTLQIKCLQV-EAEYRTLM 174 SW K IGP+ G PLGF KNGELF++ HK LV++DP T Q++ + ++ T Sbjct: 294 SWTKQLTIGPILGVEMPLGFWKNGELFLESENHK-LVMFDPCTGQLRDFGIYMSQDSTQQ 352 Query: 175 VCLYTESLVSLKG 213 + +Y ES+VS++G Sbjct: 353 LVVYAESIVSIRG 365 >ref|XP_007011145.1| F-box and associated interaction domains-containing protein isoform 1 [Theobroma cacao] gi|508728058|gb|EOY19955.1| F-box and associated interaction domains-containing protein isoform 1 [Theobroma cacao] Length = 467 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/73 (43%), Positives = 47/73 (64%), Gaps = 3/73 (4%) Frame = +1 Query: 4 SWKKLYRIGPLYGFGEPLGFSKNGELFIQL--HKPLVLWDPVTLQIKCLQV-EAEYRTLM 174 SW K IGP+ G PLGF KNGELF++ HK LV++DP T Q++ + ++ T Sbjct: 294 SWTKQLTIGPILGVEMPLGFWKNGELFLESENHK-LVMFDPCTGQLRDFGIYMSQDSTQQ 352 Query: 175 VCLYTESLVSLKG 213 + +Y ES+VS++G Sbjct: 353 LVVYAESIVSIRG 365