BLASTX nr result
ID: Paeonia24_contig00022338
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00022338 (435 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006444234.1| hypothetical protein CICLE_v10023116mg [Citr... 62 6e-08 ref|XP_004971197.1| PREDICTED: uncharacterized protein LOC101779... 59 5e-07 gb|ACG27260.1| hypothetical protein [Zea mays] 58 2e-06 gb|ACG24245.1| hypothetical protein [Zea mays] 58 2e-06 gb|ACG33595.1| hypothetical protein [Zea mays] 55 8e-06 >ref|XP_006444234.1| hypothetical protein CICLE_v10023116mg [Citrus clementina] gi|557546496|gb|ESR57474.1| hypothetical protein CICLE_v10023116mg [Citrus clementina] Length = 83 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = -2 Query: 380 MGKFCCGESDDGFSIDLMGLLMVIVLALVFMLICTPPPRRGTVAVYRL 237 MGK C E + F +D MGLLMV+VLAL M+IC PPPRR V YR+ Sbjct: 35 MGKLICSEIEQTFGLDFMGLLMVLVLALTLMVICVPPPRRYMVTAYRV 82 >ref|XP_004971197.1| PREDICTED: uncharacterized protein LOC101779627 [Setaria italica] Length = 49 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/46 (54%), Positives = 35/46 (76%) Frame = -2 Query: 380 MGKFCCGESDDGFSIDLMGLLMVIVLALVFMLICTPPPRRGTVAVY 243 MGK CC + DD + +L+GLL+ IVLAL+ +++CTPP RR +AVY Sbjct: 1 MGKLCCSQEDDEPAFNLLGLLVTIVLALLLLMMCTPPRRRRCIAVY 46 >gb|ACG27260.1| hypothetical protein [Zea mays] Length = 50 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/46 (52%), Positives = 34/46 (73%) Frame = -2 Query: 380 MGKFCCGESDDGFSIDLMGLLMVIVLALVFMLICTPPPRRGTVAVY 243 MGK CC + DD + +L+GLL+ +VLAL+ +++CTPP RR VA Y Sbjct: 1 MGKLCCSQEDDEPAFNLLGLLVTVVLALLLLMLCTPPRRRRCVAYY 46 >gb|ACG24245.1| hypothetical protein [Zea mays] Length = 50 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/46 (52%), Positives = 34/46 (73%) Frame = -2 Query: 380 MGKFCCGESDDGFSIDLMGLLMVIVLALVFMLICTPPPRRGTVAVY 243 MGK CC + DD + +L+GLL+ +VLAL+ +++CTPP RR VA Y Sbjct: 1 MGKLCCSQEDDEPAFNLLGLLVTVVLALLLLMLCTPPRRRRCVAYY 46 >gb|ACG33595.1| hypothetical protein [Zea mays] Length = 50 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/46 (50%), Positives = 33/46 (71%) Frame = -2 Query: 380 MGKFCCGESDDGFSIDLMGLLMVIVLALVFMLICTPPPRRGTVAVY 243 MGK CC + DD + +L+GLL+ +VLAL+ +++CTPP R VA Y Sbjct: 1 MGKLCCSQEDDEPAFNLLGLLVTVVLALLLLMLCTPPRRSVAVAYY 46