BLASTX nr result
ID: Paeonia24_contig00022279
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00022279 (201 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007224256.1| hypothetical protein PRUPE_ppa018408mg, part... 52 4e-07 ref|XP_007219089.1| hypothetical protein PRUPE_ppa015100mg, part... 52 4e-07 ref|XP_007226950.1| hypothetical protein PRUPE_ppa025194mg, part... 52 5e-07 ref|XP_007219137.1| hypothetical protein PRUPE_ppa015965mg [Prun... 49 5e-06 ref|XP_007203318.1| hypothetical protein PRUPE_ppa019964mg, part... 48 8e-06 >ref|XP_007224256.1| hypothetical protein PRUPE_ppa018408mg, partial [Prunus persica] gi|462421192|gb|EMJ25455.1| hypothetical protein PRUPE_ppa018408mg, partial [Prunus persica] Length = 1440 Score = 52.4 bits (124), Expect(2) = 4e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +2 Query: 62 EIKLEGNSPLPNSGLYRTSITESKEIKKQIQQLL 163 EI+L G+SPLPN GLYRTS+ ES EIKKQIQ LL Sbjct: 576 EIQLVGDSPLPNLGLYRTSLMESDEIKKQIQGLL 609 Score = 27.3 bits (59), Expect(2) = 4e-07 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 165 EQGVIKPSSSPC 200 EQGVIKPS SPC Sbjct: 610 EQGVIKPSCSPC 621 >ref|XP_007219089.1| hypothetical protein PRUPE_ppa015100mg, partial [Prunus persica] gi|462415551|gb|EMJ20288.1| hypothetical protein PRUPE_ppa015100mg, partial [Prunus persica] Length = 641 Score = 52.4 bits (124), Expect(2) = 4e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +2 Query: 62 EIKLEGNSPLPNSGLYRTSITESKEIKKQIQQLL 163 EI+L G+SPLPN GLYRTS+ ES EIKKQIQ LL Sbjct: 150 EIQLVGDSPLPNLGLYRTSLMESDEIKKQIQGLL 183 Score = 27.3 bits (59), Expect(2) = 4e-07 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 165 EQGVIKPSSSPC 200 EQGVIKPS SPC Sbjct: 184 EQGVIKPSCSPC 195 >ref|XP_007226950.1| hypothetical protein PRUPE_ppa025194mg, partial [Prunus persica] gi|462423886|gb|EMJ28149.1| hypothetical protein PRUPE_ppa025194mg, partial [Prunus persica] Length = 1347 Score = 52.4 bits (124), Expect(2) = 5e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +2 Query: 62 EIKLEGNSPLPNSGLYRTSITESKEIKKQIQQLL 163 EI+L G+SPLPN GLYRTS+ ES EIKKQIQ LL Sbjct: 503 EIQLVGDSPLPNLGLYRTSLMESDEIKKQIQGLL 536 Score = 26.9 bits (58), Expect(2) = 5e-07 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +3 Query: 165 EQGVIKPSSSPC 200 EQG+IKPS SPC Sbjct: 537 EQGIIKPSCSPC 548 >ref|XP_007219137.1| hypothetical protein PRUPE_ppa015965mg [Prunus persica] gi|462415599|gb|EMJ20336.1| hypothetical protein PRUPE_ppa015965mg [Prunus persica] Length = 1484 Score = 48.9 bits (115), Expect(2) = 5e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +2 Query: 71 LEGNSPLPNSGLYRTSITESKEIKKQIQQLL 163 ++G+SPLPN GLYRTS+ ES EIKKQIQ LL Sbjct: 592 VQGDSPLPNLGLYRTSLMESDEIKKQIQGLL 622 Score = 26.9 bits (58), Expect(2) = 5e-06 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +3 Query: 165 EQGVIKPSSSPC 200 EQG+IKPS SPC Sbjct: 623 EQGIIKPSCSPC 634 >ref|XP_007203318.1| hypothetical protein PRUPE_ppa019964mg, partial [Prunus persica] gi|462398849|gb|EMJ04517.1| hypothetical protein PRUPE_ppa019964mg, partial [Prunus persica] Length = 1488 Score = 48.1 bits (113), Expect(2) = 8e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +2 Query: 62 EIKLEGNSPLPNSGLYRTSITESKEIKKQIQQLL 163 E++L G+S LPN GLYRTS+ ES EIKKQIQ LL Sbjct: 576 ELQLVGDSHLPNLGLYRTSLMESDEIKKQIQGLL 609 Score = 26.9 bits (58), Expect(2) = 8e-06 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +3 Query: 165 EQGVIKPSSSPC 200 EQG+IKPS SPC Sbjct: 610 EQGIIKPSCSPC 621