BLASTX nr result
ID: Paeonia24_contig00022269
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00022269 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006848434.1| hypothetical protein AMTR_s00013p00237060 [A... 68 2e-09 gb|EYU45398.1| hypothetical protein MIMGU_mgv1a005489mg [Mimulus... 66 4e-09 ref|XP_007031841.1| Uridine kinase/uracil phosphoribosyltransfer... 66 4e-09 ref|XP_007215305.1| hypothetical protein PRUPE_ppa005095mg [Prun... 66 4e-09 ref|XP_003633788.1| PREDICTED: uridine kinase-like protein 1, ch... 66 4e-09 ref|XP_003633787.1| PREDICTED: uridine kinase-like protein 1, ch... 66 4e-09 emb|CBI40048.3| unnamed protein product [Vitis vinifera] 66 4e-09 emb|CBI40047.3| unnamed protein product [Vitis vinifera] 66 4e-09 ref|XP_002509535.1| Uracil phosphoribosyltransferase, putative [... 66 4e-09 ref|XP_002298617.1| uracil phosphoribosyltransferase family prot... 66 4e-09 ref|XP_006373224.1| uracil phosphoribosyltransferase family prot... 66 4e-09 emb|CAN74540.1| hypothetical protein VITISV_035160 [Vitis vinifera] 66 4e-09 gb|EXC31333.1| Uridine kinase-like protein 1 [Morus notabilis] 65 1e-08 ref|XP_006470040.1| PREDICTED: uridine kinase-like protein 1, ch... 65 1e-08 ref|XP_006470039.1| PREDICTED: uridine kinase-like protein 1, ch... 65 1e-08 ref|XP_006447097.1| hypothetical protein CICLE_v10015123mg [Citr... 65 1e-08 ref|XP_006447096.1| hypothetical protein CICLE_v10015123mg [Citr... 65 1e-08 ref|XP_006447095.1| hypothetical protein CICLE_v10015123mg [Citr... 65 1e-08 gb|EPS57314.1| hypothetical protein M569_17504, partial [Genlise... 65 1e-08 ref|XP_007161986.1| hypothetical protein PHAVU_001G114500g [Phas... 65 1e-08 >ref|XP_006848434.1| hypothetical protein AMTR_s00013p00237060 [Amborella trichopoda] gi|548851740|gb|ERN10015.1| hypothetical protein AMTR_s00013p00237060 [Amborella trichopoda] Length = 480 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 380 VTSEIDVALNEEYRVIPGMGEFGDRYFGTDD 288 VTSEIDVALNEEYRVIPGMGEFGDRYFGTDD Sbjct: 450 VTSEIDVALNEEYRVIPGMGEFGDRYFGTDD 480 >gb|EYU45398.1| hypothetical protein MIMGU_mgv1a005489mg [Mimulus guttatus] Length = 482 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 380 VTSEIDVALNEEYRVIPGMGEFGDRYFGTDD 288 VTSEIDVALNEE+RVIPGMGEFGDRYFGTDD Sbjct: 452 VTSEIDVALNEEFRVIPGMGEFGDRYFGTDD 482 >ref|XP_007031841.1| Uridine kinase/uracil phosphoribosyltransferase 1 isoform 1 [Theobroma cacao] gi|508710870|gb|EOY02767.1| Uridine kinase/uracil phosphoribosyltransferase 1 isoform 1 [Theobroma cacao] Length = 466 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 380 VTSEIDVALNEEYRVIPGMGEFGDRYFGTDD 288 VTSEIDVALNEE+RVIPGMGEFGDRYFGTDD Sbjct: 436 VTSEIDVALNEEFRVIPGMGEFGDRYFGTDD 466 >ref|XP_007215305.1| hypothetical protein PRUPE_ppa005095mg [Prunus persica] gi|462411455|gb|EMJ16504.1| hypothetical protein PRUPE_ppa005095mg [Prunus persica] Length = 477 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 380 VTSEIDVALNEEYRVIPGMGEFGDRYFGTDD 288 VTSEIDVALNEE+RVIPGMGEFGDRYFGTDD Sbjct: 447 VTSEIDVALNEEFRVIPGMGEFGDRYFGTDD 477 >ref|XP_003633788.1| PREDICTED: uridine kinase-like protein 1, chloroplastic-like isoform 2 [Vitis vinifera] Length = 481 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 380 VTSEIDVALNEEYRVIPGMGEFGDRYFGTDD 288 VTSEIDVALNEE+RVIPGMGEFGDRYFGTDD Sbjct: 451 VTSEIDVALNEEFRVIPGMGEFGDRYFGTDD 481 >ref|XP_003633787.1| PREDICTED: uridine kinase-like protein 1, chloroplastic-like isoform 1 [Vitis vinifera] Length = 482 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 380 VTSEIDVALNEEYRVIPGMGEFGDRYFGTDD 288 VTSEIDVALNEE+RVIPGMGEFGDRYFGTDD Sbjct: 452 VTSEIDVALNEEFRVIPGMGEFGDRYFGTDD 482 >emb|CBI40048.3| unnamed protein product [Vitis vinifera] Length = 267 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 380 VTSEIDVALNEEYRVIPGMGEFGDRYFGTDD 288 VTSEIDVALNEE+RVIPGMGEFGDRYFGTDD Sbjct: 237 VTSEIDVALNEEFRVIPGMGEFGDRYFGTDD 267 >emb|CBI40047.3| unnamed protein product [Vitis vinifera] Length = 896 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 380 VTSEIDVALNEEYRVIPGMGEFGDRYFGTDD 288 VTSEIDVALNEE+RVIPGMGEFGDRYFGTDD Sbjct: 866 VTSEIDVALNEEFRVIPGMGEFGDRYFGTDD 896 >ref|XP_002509535.1| Uracil phosphoribosyltransferase, putative [Ricinus communis] gi|223549434|gb|EEF50922.1| Uracil phosphoribosyltransferase, putative [Ricinus communis] Length = 481 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 380 VTSEIDVALNEEYRVIPGMGEFGDRYFGTDD 288 VTSEIDVALNEE+RVIPGMGEFGDRYFGTDD Sbjct: 451 VTSEIDVALNEEFRVIPGMGEFGDRYFGTDD 481 >ref|XP_002298617.1| uracil phosphoribosyltransferase family protein [Populus trichocarpa] gi|222845875|gb|EEE83422.1| uracil phosphoribosyltransferase family protein [Populus trichocarpa] Length = 481 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 380 VTSEIDVALNEEYRVIPGMGEFGDRYFGTDD 288 VTSEIDVALNEE+RVIPGMGEFGDRYFGTDD Sbjct: 451 VTSEIDVALNEEFRVIPGMGEFGDRYFGTDD 481 >ref|XP_006373224.1| uracil phosphoribosyltransferase family protein [Populus trichocarpa] gi|550319930|gb|ERP51021.1| uracil phosphoribosyltransferase family protein [Populus trichocarpa] Length = 477 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 380 VTSEIDVALNEEYRVIPGMGEFGDRYFGTDD 288 VTSEIDVALNEE+RVIPGMGEFGDRYFGTDD Sbjct: 447 VTSEIDVALNEEFRVIPGMGEFGDRYFGTDD 477 >emb|CAN74540.1| hypothetical protein VITISV_035160 [Vitis vinifera] Length = 139 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 380 VTSEIDVALNEEYRVIPGMGEFGDRYFGTDD 288 VTSEIDVALNEE+RVIPGMGEFGDRYFGTDD Sbjct: 109 VTSEIDVALNEEFRVIPGMGEFGDRYFGTDD 139 >gb|EXC31333.1| Uridine kinase-like protein 1 [Morus notabilis] Length = 484 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 380 VTSEIDVALNEEYRVIPGMGEFGDRYFGTDD 288 VTSEIDVALNEE+RVIPG+GEFGDRYFGTDD Sbjct: 453 VTSEIDVALNEEFRVIPGLGEFGDRYFGTDD 483 >ref|XP_006470040.1| PREDICTED: uridine kinase-like protein 1, chloroplastic-like isoform X3 [Citrus sinensis] Length = 454 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 380 VTSEIDVALNEEYRVIPGMGEFGDRYFGTDD 288 VTSEIDVALNEE+RVIPG+GEFGDRYFGTDD Sbjct: 424 VTSEIDVALNEEFRVIPGLGEFGDRYFGTDD 454 >ref|XP_006470039.1| PREDICTED: uridine kinase-like protein 1, chloroplastic-like isoform X2 [Citrus sinensis] Length = 471 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 380 VTSEIDVALNEEYRVIPGMGEFGDRYFGTDD 288 VTSEIDVALNEE+RVIPG+GEFGDRYFGTDD Sbjct: 441 VTSEIDVALNEEFRVIPGLGEFGDRYFGTDD 471 >ref|XP_006447097.1| hypothetical protein CICLE_v10015123mg [Citrus clementina] gi|568831582|ref|XP_006470041.1| PREDICTED: uridine kinase-like protein 1, chloroplastic-like isoform X4 [Citrus sinensis] gi|557549708|gb|ESR60337.1| hypothetical protein CICLE_v10015123mg [Citrus clementina] Length = 453 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 380 VTSEIDVALNEEYRVIPGMGEFGDRYFGTDD 288 VTSEIDVALNEE+RVIPG+GEFGDRYFGTDD Sbjct: 423 VTSEIDVALNEEFRVIPGLGEFGDRYFGTDD 453 >ref|XP_006447096.1| hypothetical protein CICLE_v10015123mg [Citrus clementina] gi|568831576|ref|XP_006470038.1| PREDICTED: uridine kinase-like protein 1, chloroplastic-like isoform X1 [Citrus sinensis] gi|557549707|gb|ESR60336.1| hypothetical protein CICLE_v10015123mg [Citrus clementina] Length = 472 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 380 VTSEIDVALNEEYRVIPGMGEFGDRYFGTDD 288 VTSEIDVALNEE+RVIPG+GEFGDRYFGTDD Sbjct: 442 VTSEIDVALNEEFRVIPGLGEFGDRYFGTDD 472 >ref|XP_006447095.1| hypothetical protein CICLE_v10015123mg [Citrus clementina] gi|557549706|gb|ESR60335.1| hypothetical protein CICLE_v10015123mg [Citrus clementina] Length = 463 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 380 VTSEIDVALNEEYRVIPGMGEFGDRYFGTDD 288 VTSEIDVALNEE+RVIPG+GEFGDRYFGTDD Sbjct: 433 VTSEIDVALNEEFRVIPGLGEFGDRYFGTDD 463 >gb|EPS57314.1| hypothetical protein M569_17504, partial [Genlisea aurea] Length = 77 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 380 VTSEIDVALNEEYRVIPGMGEFGDRYFGTDD 288 VTSEIDV LN+EYRVIPGMGEFGDRYFGTDD Sbjct: 47 VTSEIDVGLNDEYRVIPGMGEFGDRYFGTDD 77 >ref|XP_007161986.1| hypothetical protein PHAVU_001G114500g [Phaseolus vulgaris] gi|561035450|gb|ESW33980.1| hypothetical protein PHAVU_001G114500g [Phaseolus vulgaris] Length = 473 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 380 VTSEIDVALNEEYRVIPGMGEFGDRYFGTDD 288 VTSEIDV LNEEYRVIPG+GEFGDRYFGTDD Sbjct: 443 VTSEIDVELNEEYRVIPGLGEFGDRYFGTDD 473