BLASTX nr result
ID: Paeonia24_contig00021795
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00021795 (228 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006484888.1| PREDICTED: callose synthase 7-like isoform X... 88 1e-15 ref|XP_006484887.1| PREDICTED: callose synthase 7-like isoform X... 88 1e-15 ref|XP_006484886.1| PREDICTED: callose synthase 7-like isoform X... 88 1e-15 ref|XP_006437155.1| hypothetical protein CICLE_v10030478mg [Citr... 88 1e-15 ref|XP_006437154.1| hypothetical protein CICLE_v10030478mg [Citr... 88 1e-15 ref|XP_007048880.1| Glucan synthase-like 7 [Theobroma cacao] gi|... 88 1e-15 ref|XP_006484915.1| PREDICTED: callose synthase 7-like isoform X... 87 2e-15 ref|XP_006484914.1| PREDICTED: callose synthase 7-like isoform X... 87 2e-15 ref|XP_006484913.1| PREDICTED: callose synthase 7-like isoform X... 87 2e-15 ref|XP_006484912.1| PREDICTED: callose synthase 7-like isoform X... 87 2e-15 ref|XP_006348959.1| PREDICTED: callose synthase 7-like [Solanum ... 87 2e-15 ref|XP_006437120.1| hypothetical protein CICLE_v10030560mg [Citr... 87 2e-15 ref|XP_006437119.1| hypothetical protein CICLE_v10030560mg [Citr... 87 2e-15 ref|XP_006437118.1| hypothetical protein CICLE_v10030560mg [Citr... 87 2e-15 ref|XP_004243209.1| PREDICTED: callose synthase 7-like [Solanum ... 87 2e-15 ref|XP_002526651.1| transferase, transferring glycosyl groups, p... 87 2e-15 ref|XP_002307554.1| GLUCAN SYNTHASE-LIKE 11 family protein [Popu... 87 2e-15 ref|XP_002300874.1| GLUCAN SYNTHASE-LIKE 11 family protein [Popu... 87 2e-15 gb|EYU32396.1| hypothetical protein MIMGU_mgv1a024191mg [Mimulus... 86 5e-15 gb|ADK87343.1| callose synthase 7 [Arabidopsis thaliana] 86 7e-15 >ref|XP_006484888.1| PREDICTED: callose synthase 7-like isoform X3 [Citrus sinensis] Length = 1890 Score = 87.8 bits (216), Expect = 1e-15 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +1 Query: 79 GSWLFAPFVFNPSGFEWQKTVDDWTDWKGWMGNCGGIGFE 198 GSWLFAPFVFNPSGF+WQKTVDDWTDWK WMGN GGIG + Sbjct: 1636 GSWLFAPFVFNPSGFDWQKTVDDWTDWKRWMGNRGGIGIQ 1675 >ref|XP_006484887.1| PREDICTED: callose synthase 7-like isoform X2 [Citrus sinensis] Length = 1922 Score = 87.8 bits (216), Expect = 1e-15 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +1 Query: 79 GSWLFAPFVFNPSGFEWQKTVDDWTDWKGWMGNCGGIGFE 198 GSWLFAPFVFNPSGF+WQKTVDDWTDWK WMGN GGIG + Sbjct: 1668 GSWLFAPFVFNPSGFDWQKTVDDWTDWKRWMGNRGGIGIQ 1707 >ref|XP_006484886.1| PREDICTED: callose synthase 7-like isoform X1 [Citrus sinensis] Length = 1924 Score = 87.8 bits (216), Expect = 1e-15 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +1 Query: 79 GSWLFAPFVFNPSGFEWQKTVDDWTDWKGWMGNCGGIGFE 198 GSWLFAPFVFNPSGF+WQKTVDDWTDWK WMGN GGIG + Sbjct: 1670 GSWLFAPFVFNPSGFDWQKTVDDWTDWKRWMGNRGGIGIQ 1709 >ref|XP_006437155.1| hypothetical protein CICLE_v10030478mg [Citrus clementina] gi|557539351|gb|ESR50395.1| hypothetical protein CICLE_v10030478mg [Citrus clementina] Length = 1776 Score = 87.8 bits (216), Expect = 1e-15 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +1 Query: 79 GSWLFAPFVFNPSGFEWQKTVDDWTDWKGWMGNCGGIGFE 198 GSWLFAPFVFNPSGF+WQKTVDDWTDWK WMGN GGIG + Sbjct: 1522 GSWLFAPFVFNPSGFDWQKTVDDWTDWKRWMGNRGGIGIQ 1561 >ref|XP_006437154.1| hypothetical protein CICLE_v10030478mg [Citrus clementina] gi|557539350|gb|ESR50394.1| hypothetical protein CICLE_v10030478mg [Citrus clementina] Length = 1922 Score = 87.8 bits (216), Expect = 1e-15 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +1 Query: 79 GSWLFAPFVFNPSGFEWQKTVDDWTDWKGWMGNCGGIGFE 198 GSWLFAPFVFNPSGF+WQKTVDDWTDWK WMGN GGIG + Sbjct: 1668 GSWLFAPFVFNPSGFDWQKTVDDWTDWKRWMGNRGGIGIQ 1707 >ref|XP_007048880.1| Glucan synthase-like 7 [Theobroma cacao] gi|508701141|gb|EOX93037.1| Glucan synthase-like 7 [Theobroma cacao] Length = 1929 Score = 87.8 bits (216), Expect = 1e-15 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +1 Query: 79 GSWLFAPFVFNPSGFEWQKTVDDWTDWKGWMGNCGGIGFE 198 GSWLFAPFVFNPSGF+WQKTVDDWTDWK WMGN GGIG + Sbjct: 1672 GSWLFAPFVFNPSGFDWQKTVDDWTDWKRWMGNRGGIGID 1711 >ref|XP_006484915.1| PREDICTED: callose synthase 7-like isoform X4 [Citrus sinensis] Length = 1904 Score = 87.0 bits (214), Expect = 2e-15 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +1 Query: 79 GSWLFAPFVFNPSGFEWQKTVDDWTDWKGWMGNCGGIG 192 GSWLFAPFVFNPSGF+WQKTVDDWTDWK WMGN GGIG Sbjct: 1648 GSWLFAPFVFNPSGFDWQKTVDDWTDWKRWMGNRGGIG 1685 >ref|XP_006484914.1| PREDICTED: callose synthase 7-like isoform X3 [Citrus sinensis] Length = 1535 Score = 87.0 bits (214), Expect = 2e-15 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +1 Query: 79 GSWLFAPFVFNPSGFEWQKTVDDWTDWKGWMGNCGGIG 192 GSWLFAPFVFNPSGF+WQKTVDDWTDWK WMGN GGIG Sbjct: 1289 GSWLFAPFVFNPSGFDWQKTVDDWTDWKRWMGNRGGIG 1326 >ref|XP_006484913.1| PREDICTED: callose synthase 7-like isoform X2 [Citrus sinensis] Length = 1544 Score = 87.0 bits (214), Expect = 2e-15 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +1 Query: 79 GSWLFAPFVFNPSGFEWQKTVDDWTDWKGWMGNCGGIG 192 GSWLFAPFVFNPSGF+WQKTVDDWTDWK WMGN GGIG Sbjct: 1288 GSWLFAPFVFNPSGFDWQKTVDDWTDWKRWMGNRGGIG 1325 >ref|XP_006484912.1| PREDICTED: callose synthase 7-like isoform X1 [Citrus sinensis] Length = 1545 Score = 87.0 bits (214), Expect = 2e-15 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +1 Query: 79 GSWLFAPFVFNPSGFEWQKTVDDWTDWKGWMGNCGGIG 192 GSWLFAPFVFNPSGF+WQKTVDDWTDWK WMGN GGIG Sbjct: 1289 GSWLFAPFVFNPSGFDWQKTVDDWTDWKRWMGNRGGIG 1326 >ref|XP_006348959.1| PREDICTED: callose synthase 7-like [Solanum tuberosum] Length = 1911 Score = 87.0 bits (214), Expect = 2e-15 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +1 Query: 79 GSWLFAPFVFNPSGFEWQKTVDDWTDWKGWMGNCGGIG 192 GSWLFAPFVFNPSGF+WQKTVDDWTDWK WMGN GGIG Sbjct: 1659 GSWLFAPFVFNPSGFDWQKTVDDWTDWKRWMGNRGGIG 1696 >ref|XP_006437120.1| hypothetical protein CICLE_v10030560mg [Citrus clementina] gi|557539316|gb|ESR50360.1| hypothetical protein CICLE_v10030560mg [Citrus clementina] Length = 1130 Score = 87.0 bits (214), Expect = 2e-15 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +1 Query: 79 GSWLFAPFVFNPSGFEWQKTVDDWTDWKGWMGNCGGIG 192 GSWLFAPFVFNPSGF+WQKTVDDWTDWK WMGN GGIG Sbjct: 874 GSWLFAPFVFNPSGFDWQKTVDDWTDWKRWMGNRGGIG 911 >ref|XP_006437119.1| hypothetical protein CICLE_v10030560mg [Citrus clementina] gi|557539315|gb|ESR50359.1| hypothetical protein CICLE_v10030560mg [Citrus clementina] Length = 1027 Score = 87.0 bits (214), Expect = 2e-15 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +1 Query: 79 GSWLFAPFVFNPSGFEWQKTVDDWTDWKGWMGNCGGIG 192 GSWLFAPFVFNPSGF+WQKTVDDWTDWK WMGN GGIG Sbjct: 874 GSWLFAPFVFNPSGFDWQKTVDDWTDWKRWMGNRGGIG 911 >ref|XP_006437118.1| hypothetical protein CICLE_v10030560mg [Citrus clementina] gi|557539314|gb|ESR50358.1| hypothetical protein CICLE_v10030560mg [Citrus clementina] Length = 742 Score = 87.0 bits (214), Expect = 2e-15 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +1 Query: 79 GSWLFAPFVFNPSGFEWQKTVDDWTDWKGWMGNCGGIG 192 GSWLFAPFVFNPSGF+WQKTVDDWTDWK WMGN GGIG Sbjct: 486 GSWLFAPFVFNPSGFDWQKTVDDWTDWKRWMGNRGGIG 523 >ref|XP_004243209.1| PREDICTED: callose synthase 7-like [Solanum lycopersicum] Length = 1912 Score = 87.0 bits (214), Expect = 2e-15 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +1 Query: 79 GSWLFAPFVFNPSGFEWQKTVDDWTDWKGWMGNCGGIG 192 GSWLFAPFVFNPSGF+WQKTVDDWTDWK WMGN GGIG Sbjct: 1660 GSWLFAPFVFNPSGFDWQKTVDDWTDWKRWMGNRGGIG 1697 >ref|XP_002526651.1| transferase, transferring glycosyl groups, putative [Ricinus communis] gi|223534018|gb|EEF35739.1| transferase, transferring glycosyl groups, putative [Ricinus communis] Length = 1911 Score = 87.0 bits (214), Expect = 2e-15 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +1 Query: 79 GSWLFAPFVFNPSGFEWQKTVDDWTDWKGWMGNCGGIG 192 GSWLFAPFVFNPSGF+WQKTVDDWTDWK WMGN GGIG Sbjct: 1655 GSWLFAPFVFNPSGFDWQKTVDDWTDWKRWMGNRGGIG 1692 >ref|XP_002307554.1| GLUCAN SYNTHASE-LIKE 11 family protein [Populus trichocarpa] gi|222857003|gb|EEE94550.1| GLUCAN SYNTHASE-LIKE 11 family protein [Populus trichocarpa] Length = 1944 Score = 87.0 bits (214), Expect = 2e-15 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +1 Query: 79 GSWLFAPFVFNPSGFEWQKTVDDWTDWKGWMGNCGGIG 192 GSWLFAPFVFNPSGF+WQKTVDDWTDWK WMGN GGIG Sbjct: 1681 GSWLFAPFVFNPSGFDWQKTVDDWTDWKRWMGNRGGIG 1718 >ref|XP_002300874.1| GLUCAN SYNTHASE-LIKE 11 family protein [Populus trichocarpa] gi|222842600|gb|EEE80147.1| GLUCAN SYNTHASE-LIKE 11 family protein [Populus trichocarpa] Length = 1940 Score = 87.0 bits (214), Expect = 2e-15 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +1 Query: 79 GSWLFAPFVFNPSGFEWQKTVDDWTDWKGWMGNCGGIG 192 GSWLFAPFVFNPSGF+WQKTVDDWTDWK WMGN GGIG Sbjct: 1666 GSWLFAPFVFNPSGFDWQKTVDDWTDWKRWMGNRGGIG 1703 >gb|EYU32396.1| hypothetical protein MIMGU_mgv1a024191mg [Mimulus guttatus] Length = 1907 Score = 85.9 bits (211), Expect = 5e-15 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = +1 Query: 82 SWLFAPFVFNPSGFEWQKTVDDWTDWKGWMGNCGGIG 192 SWLFAPFVFNPSGFEWQKTVDDWTDWK WMGN GGIG Sbjct: 1656 SWLFAPFVFNPSGFEWQKTVDDWTDWKRWMGNRGGIG 1692 >gb|ADK87343.1| callose synthase 7 [Arabidopsis thaliana] Length = 1933 Score = 85.5 bits (210), Expect = 7e-15 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +1 Query: 82 SWLFAPFVFNPSGFEWQKTVDDWTDWKGWMGNCGGIG 192 SWLFAPF+FNPSGFEWQKTVDDWTDWK WMGN GGIG Sbjct: 1680 SWLFAPFIFNPSGFEWQKTVDDWTDWKRWMGNRGGIG 1716