BLASTX nr result
ID: Paeonia24_contig00021780
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00021780 (320 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC21746.1| Inactive protein kinase [Morus notabilis] 56 4e-06 >gb|EXC21746.1| Inactive protein kinase [Morus notabilis] Length = 699 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/51 (50%), Positives = 35/51 (68%) Frame = -3 Query: 153 KKESDSCLLQLDCNIILVDHAIPKILKAVDQPTARKVYMNRPQTDPTVADM 1 K+ESD C+ L+CNI+L+DHA+PKILKAV+ PT + Q D + DM Sbjct: 133 KRESDYCVKLLNCNIVLMDHAMPKILKAVNLPTVKSFNKGNHQIDESENDM 183