BLASTX nr result
ID: Paeonia24_contig00021508
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00021508 (292 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007040370.1| Late embryogenesis abundant hydroxyproline-r... 57 2e-06 >ref|XP_007040370.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein, putative [Theobroma cacao] gi|508777615|gb|EOY24871.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein, putative [Theobroma cacao] Length = 215 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/53 (50%), Positives = 34/53 (64%) Frame = +1 Query: 133 MADKDQAARPFAQANGHVRSDQESGGGLTKEQKKKRNMKRLAYFAIFVVFQII 291 MA+KDQ P A ANGH RSD+ES +KE K+K+ +K Y A F VFQ + Sbjct: 1 MAEKDQQVHPLAPANGHPRSDEESASLQSKELKRKKRIKYAVYIAAFAVFQTV 53