BLASTX nr result
ID: Paeonia24_contig00020739
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00020739 (394 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFV68275.1| allene oxide cyclase [Catharanthus roseus] 55 8e-06 >gb|AFV68275.1| allene oxide cyclase [Catharanthus roseus] Length = 251 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = +3 Query: 279 LQKSLGITSSLCILKKNEPENKEDWDKAIYDFYYRDYG 392 LQK LGITS +CIL KNEPE K D +AIY FY+ DYG Sbjct: 124 LQKRLGITSGICILIKNEPEKKGDRYEAIYSFYFGDYG 161