BLASTX nr result
ID: Paeonia24_contig00020006
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00020006 (336 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533540.1| SP1L, putative [Ricinus communis] gi|2235265... 56 6e-06 >ref|XP_002533540.1| SP1L, putative [Ricinus communis] gi|223526590|gb|EEF28843.1| SP1L, putative [Ricinus communis] Length = 107 Score = 55.8 bits (133), Expect = 6e-06 Identities = 33/60 (55%), Positives = 40/60 (66%), Gaps = 3/60 (5%) Frame = -2 Query: 248 GGGETI---PSATKPGQAAANNIPPLKPTVSLDPVHNSKQIPADIHGNLTNIYHQADG*N 78 G GET P+A GQAA NN P KP V+ P++ K+IPA IHGNLTN Y++ADG N Sbjct: 19 GNGETANNSPAAKSVGQAA-NNSPSPKPVVASPPIN--KEIPAGIHGNLTNNYYRADGQN 75