BLASTX nr result
ID: Paeonia24_contig00019650
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00019650 (293 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006480467.1| PREDICTED: calreticulin-3-like isoform X2 [C... 63 5e-08 ref|XP_006480466.1| PREDICTED: calreticulin-3-like isoform X1 [C... 63 5e-08 ref|XP_006340043.1| PREDICTED: calreticulin-3-like isoform X2 [S... 63 5e-08 ref|XP_006340042.1| PREDICTED: calreticulin-3-like isoform X1 [S... 63 5e-08 ref|XP_006428650.1| hypothetical protein CICLE_v10011848mg [Citr... 63 5e-08 ref|XP_006428648.1| hypothetical protein CICLE_v10011848mg [Citr... 63 5e-08 ref|XP_004237555.1| PREDICTED: calreticulin-3-like isoform 2 [So... 63 5e-08 ref|XP_004237554.1| PREDICTED: calreticulin-3-like isoform 1 [So... 63 5e-08 ref|XP_007029192.1| Calreticulin 3 isoform 2 [Theobroma cacao] g... 62 8e-08 ref|XP_007029191.1| Calreticulin 3 isoform 1 [Theobroma cacao] g... 62 8e-08 ref|XP_002514817.1| calreticulin, putative [Ricinus communis] gi... 62 1e-07 ref|XP_002325909.1| hypothetical protein POPTR_0019s08290g [Popu... 61 1e-07 gb|EXB88156.1| hypothetical protein L484_005581 [Morus notabilis] 60 2e-07 gb|EXB23135.1| hypothetical protein L484_016150 [Morus notabilis] 60 2e-07 ref|XP_006478745.1| PREDICTED: calreticulin-3-like isoform X1 [C... 60 2e-07 ref|XP_006345782.1| PREDICTED: calreticulin-3-like [Solanum tube... 60 2e-07 ref|XP_006442972.1| hypothetical protein CICLE_v10020358mg [Citr... 60 2e-07 ref|XP_006417689.1| hypothetical protein EUTSA_v10007710mg [Eutr... 60 2e-07 ref|XP_006417688.1| hypothetical protein EUTSA_v10007710mg [Eutr... 60 2e-07 ref|XP_006372833.1| hypothetical protein POPTR_0017s05490g [Popu... 60 2e-07 >ref|XP_006480467.1| PREDICTED: calreticulin-3-like isoform X2 [Citrus sinensis] Length = 405 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 96 VILSYRGENYPIKKELECKTDKLTHFYTFI 7 VILSY+G+NYPIKKELEC+TDKLTHFYTFI Sbjct: 144 VILSYQGQNYPIKKELECETDKLTHFYTFI 173 >ref|XP_006480466.1| PREDICTED: calreticulin-3-like isoform X1 [Citrus sinensis] Length = 414 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 96 VILSYRGENYPIKKELECKTDKLTHFYTFI 7 VILSY+G+NYPIKKELEC+TDKLTHFYTFI Sbjct: 144 VILSYQGQNYPIKKELECETDKLTHFYTFI 173 >ref|XP_006340043.1| PREDICTED: calreticulin-3-like isoform X2 [Solanum tuberosum] Length = 411 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 96 VILSYRGENYPIKKELECKTDKLTHFYTFI 7 VILSY+G+NYPIKKELEC+TDKLTHFYTFI Sbjct: 145 VILSYQGQNYPIKKELECETDKLTHFYTFI 174 >ref|XP_006340042.1| PREDICTED: calreticulin-3-like isoform X1 [Solanum tuberosum] Length = 427 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 96 VILSYRGENYPIKKELECKTDKLTHFYTFI 7 VILSY+G+NYPIKKELEC+TDKLTHFYTFI Sbjct: 145 VILSYQGQNYPIKKELECETDKLTHFYTFI 174 >ref|XP_006428650.1| hypothetical protein CICLE_v10011848mg [Citrus clementina] gi|557530707|gb|ESR41890.1| hypothetical protein CICLE_v10011848mg [Citrus clementina] Length = 414 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 96 VILSYRGENYPIKKELECKTDKLTHFYTFI 7 VILSY+G+NYPIKKELEC+TDKLTHFYTFI Sbjct: 144 VILSYQGQNYPIKKELECETDKLTHFYTFI 173 >ref|XP_006428648.1| hypothetical protein CICLE_v10011848mg [Citrus clementina] gi|567872119|ref|XP_006428649.1| hypothetical protein CICLE_v10011848mg [Citrus clementina] gi|567872123|ref|XP_006428651.1| hypothetical protein CICLE_v10011848mg [Citrus clementina] gi|567872125|ref|XP_006428652.1| hypothetical protein CICLE_v10011848mg [Citrus clementina] gi|567872127|ref|XP_006428653.1| hypothetical protein CICLE_v10011848mg [Citrus clementina] gi|557530705|gb|ESR41888.1| hypothetical protein CICLE_v10011848mg [Citrus clementina] gi|557530706|gb|ESR41889.1| hypothetical protein CICLE_v10011848mg [Citrus clementina] gi|557530708|gb|ESR41891.1| hypothetical protein CICLE_v10011848mg [Citrus clementina] gi|557530709|gb|ESR41892.1| hypothetical protein CICLE_v10011848mg [Citrus clementina] gi|557530710|gb|ESR41893.1| hypothetical protein CICLE_v10011848mg [Citrus clementina] Length = 362 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 96 VILSYRGENYPIKKELECKTDKLTHFYTFI 7 VILSY+G+NYPIKKELEC+TDKLTHFYTFI Sbjct: 144 VILSYQGQNYPIKKELECETDKLTHFYTFI 173 >ref|XP_004237555.1| PREDICTED: calreticulin-3-like isoform 2 [Solanum lycopersicum] Length = 413 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 96 VILSYRGENYPIKKELECKTDKLTHFYTFI 7 VILSY+G+NYPIKKELEC+TDKLTHFYTFI Sbjct: 146 VILSYQGQNYPIKKELECETDKLTHFYTFI 175 >ref|XP_004237554.1| PREDICTED: calreticulin-3-like isoform 1 [Solanum lycopersicum] Length = 430 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 96 VILSYRGENYPIKKELECKTDKLTHFYTFI 7 VILSY+G+NYPIKKELEC+TDKLTHFYTFI Sbjct: 146 VILSYQGQNYPIKKELECETDKLTHFYTFI 175 >ref|XP_007029192.1| Calreticulin 3 isoform 2 [Theobroma cacao] gi|508717797|gb|EOY09694.1| Calreticulin 3 isoform 2 [Theobroma cacao] Length = 389 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -3 Query: 96 VILSYRGENYPIKKELECKTDKLTHFYTFI 7 VILSY+G+NYP+KKELEC+TDKLTHFYTFI Sbjct: 151 VILSYQGQNYPLKKELECETDKLTHFYTFI 180 >ref|XP_007029191.1| Calreticulin 3 isoform 1 [Theobroma cacao] gi|508717796|gb|EOY09693.1| Calreticulin 3 isoform 1 [Theobroma cacao] Length = 423 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -3 Query: 96 VILSYRGENYPIKKELECKTDKLTHFYTFI 7 VILSY+G+NYP+KKELEC+TDKLTHFYTFI Sbjct: 151 VILSYQGQNYPLKKELECETDKLTHFYTFI 180 >ref|XP_002514817.1| calreticulin, putative [Ricinus communis] gi|223545868|gb|EEF47371.1| calreticulin, putative [Ricinus communis] Length = 423 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -3 Query: 96 VILSYRGENYPIKKELECKTDKLTHFYTFI 7 VILSY+G+NYPI+KELEC+TDKLTHFYTFI Sbjct: 156 VILSYQGQNYPIRKELECETDKLTHFYTFI 185 >ref|XP_002325909.1| hypothetical protein POPTR_0019s08290g [Populus trichocarpa] gi|222862784|gb|EEF00291.1| hypothetical protein POPTR_0019s08290g [Populus trichocarpa] Length = 421 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -3 Query: 96 VILSYRGENYPIKKELECKTDKLTHFYTFI 7 VILSY+G+NYPIKK+LEC+TDKLTHFYTF+ Sbjct: 151 VILSYQGQNYPIKKDLECETDKLTHFYTFV 180 >gb|EXB88156.1| hypothetical protein L484_005581 [Morus notabilis] Length = 414 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -3 Query: 96 VILSYRGENYPIKKELECKTDKLTHFYTFI 7 VILSY+G+NYPIKK+L+C+TDKLTHFYTFI Sbjct: 154 VILSYQGQNYPIKKDLQCETDKLTHFYTFI 183 >gb|EXB23135.1| hypothetical protein L484_016150 [Morus notabilis] Length = 403 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -3 Query: 96 VILSYRGENYPIKKELECKTDKLTHFYTFI 7 VILSY+G+NYPIKK+L+C+TDKLTHFYTFI Sbjct: 146 VILSYQGQNYPIKKDLQCETDKLTHFYTFI 175 >ref|XP_006478745.1| PREDICTED: calreticulin-3-like isoform X1 [Citrus sinensis] Length = 416 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -3 Query: 96 VILSYRGENYPIKKELECKTDKLTHFYTFI 7 VILSY+G+NYPIKK+L+C+TDKLTHFYTFI Sbjct: 148 VILSYQGQNYPIKKDLQCETDKLTHFYTFI 177 >ref|XP_006345782.1| PREDICTED: calreticulin-3-like [Solanum tuberosum] Length = 433 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -3 Query: 96 VILSYRGENYPIKKELECKTDKLTHFYTFI 7 VILSY+G+NYPIKK+L+C+TDKLTHFYTFI Sbjct: 163 VILSYQGQNYPIKKDLQCETDKLTHFYTFI 192 >ref|XP_006442972.1| hypothetical protein CICLE_v10020358mg [Citrus clementina] gi|568850059|ref|XP_006478746.1| PREDICTED: calreticulin-3-like isoform X2 [Citrus sinensis] gi|557545234|gb|ESR56212.1| hypothetical protein CICLE_v10020358mg [Citrus clementina] Length = 415 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -3 Query: 96 VILSYRGENYPIKKELECKTDKLTHFYTFI 7 VILSY+G+NYPIKK+L+C+TDKLTHFYTFI Sbjct: 148 VILSYQGQNYPIKKDLQCETDKLTHFYTFI 177 >ref|XP_006417689.1| hypothetical protein EUTSA_v10007710mg [Eutrema salsugineum] gi|557095460|gb|ESQ36042.1| hypothetical protein EUTSA_v10007710mg [Eutrema salsugineum] Length = 425 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -3 Query: 96 VILSYRGENYPIKKELECKTDKLTHFYTFI 7 VILSY+G+NYPIKK+L+C+TDKLTHFYTFI Sbjct: 156 VILSYQGQNYPIKKDLQCETDKLTHFYTFI 185 >ref|XP_006417688.1| hypothetical protein EUTSA_v10007710mg [Eutrema salsugineum] gi|557095459|gb|ESQ36041.1| hypothetical protein EUTSA_v10007710mg [Eutrema salsugineum] Length = 419 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -3 Query: 96 VILSYRGENYPIKKELECKTDKLTHFYTFI 7 VILSY+G+NYPIKK+L+C+TDKLTHFYTFI Sbjct: 156 VILSYQGQNYPIKKDLQCETDKLTHFYTFI 185 >ref|XP_006372833.1| hypothetical protein POPTR_0017s05490g [Populus trichocarpa] gi|550319481|gb|ERP50630.1| hypothetical protein POPTR_0017s05490g [Populus trichocarpa] Length = 424 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -3 Query: 96 VILSYRGENYPIKKELECKTDKLTHFYTFI 7 VILSY+G+NYPIKK+L+C+TDKLTHFYTFI Sbjct: 161 VILSYQGQNYPIKKDLQCETDKLTHFYTFI 190