BLASTX nr result
ID: Paeonia24_contig00019520
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00019520 (403 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276456.1| PREDICTED: pentatricopeptide repeat-containi... 63 4e-08 emb|CAN65709.1| hypothetical protein VITISV_020733 [Vitis vinifera] 63 4e-08 >ref|XP_002276456.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19191, mitochondrial [Vitis vinifera] gi|296082485|emb|CBI21490.3| unnamed protein product [Vitis vinifera] Length = 637 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/50 (60%), Positives = 36/50 (72%) Frame = +1 Query: 25 MVISAFAQRFNRFPNLSDIGMWNCNIKEAVSQGHAQKALLLFRQMKQKGI 174 MV A Q FNRF NL + WN +I E+V+QG+A KALLLFRQMKQ G+ Sbjct: 1 MVTPAATQSFNRFSNLWTVAQWNSSITESVNQGYAHKALLLFRQMKQNGL 50 >emb|CAN65709.1| hypothetical protein VITISV_020733 [Vitis vinifera] Length = 609 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/50 (60%), Positives = 36/50 (72%) Frame = +1 Query: 25 MVISAFAQRFNRFPNLSDIGMWNCNIKEAVSQGHAQKALLLFRQMKQKGI 174 MV A Q FNRF NL + WN +I E+V+QG+A KALLLFRQMKQ G+ Sbjct: 1 MVTPAATQSFNRFSNLWTVAQWNSSITESVNQGYAHKALLLFRQMKQNGL 50