BLASTX nr result
ID: Paeonia24_contig00019350
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00019350 (859 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFN70435.1| multiprotein bridging factor 1 transcriptional co... 83 2e-13 ref|XP_007013216.1| Multiprotein bridging factor 1C [Theobroma c... 80 8e-13 ref|XP_006298630.1| hypothetical protein CARUB_v10014716mg [Caps... 80 8e-13 ref|XP_007202731.1| hypothetical protein PRUPE_ppa013016mg [Prun... 78 4e-12 ref|XP_006418740.1| hypothetical protein EUTSA_v10002703mg [Eutr... 77 6e-12 ref|NP_189093.1| multiprotein-bridging factor 1c [Arabidopsis th... 76 1e-11 ref|NP_001189962.1| multiprotein-bridging factor 1c [Arabidopsis... 76 1e-11 gb|AAM62814.1| ethylene-responsive transcriptional coactivator, ... 76 1e-11 ref|XP_002883523.1| ATMBF1C/MBF1C [Arabidopsis lyrata subsp. lyr... 76 2e-11 ref|XP_004139340.1| PREDICTED: multiprotein-bridging factor 1c-l... 75 2e-11 ref|XP_002284605.1| PREDICTED: multiprotein-bridging factor 1c [... 75 2e-11 emb|CAN79519.1| hypothetical protein VITISV_034625 [Vitis vinifera] 75 2e-11 gb|EXB37038.1| Multiprotein-bridging factor 1c [Morus notabilis] 75 3e-11 gb|EXB37036.1| Multiprotein-bridging factor 1c [Morus notabilis] 75 3e-11 ref|XP_002324409.1| ethylene-responsive transcriptional coactiva... 74 5e-11 ref|XP_002514331.1| Multiprotein-bridging factor, putative [Rici... 72 3e-10 gb|AGQ57014.1| ethylene-responsive transcriptional coactivator [... 72 4e-10 ref|XP_007152816.1| hypothetical protein PHAVU_004G162100g [Phas... 71 5e-10 ref|XP_004512966.1| PREDICTED: multiprotein-bridging factor 1c-l... 71 5e-10 gb|AAL32037.2|AF439278_1 ethylene-responsive transciptional coac... 69 2e-09 >gb|AFN70435.1| multiprotein bridging factor 1 transcriptional coactivator [Gossypium hirsutum] Length = 145 Score = 82.8 bits (203), Expect = 2e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 2 AVTQDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 127 AVTQDWEPVVLHKSKPK+ DLRDPKAVNQALRSG PVQT+KK Sbjct: 8 AVTQDWEPVVLHKSKPKAQDLRDPKAVNQALRSGAPVQTIKK 49 >ref|XP_007013216.1| Multiprotein bridging factor 1C [Theobroma cacao] gi|508783579|gb|EOY30835.1| Multiprotein bridging factor 1C [Theobroma cacao] Length = 98 Score = 80.5 bits (197), Expect = 8e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +2 Query: 2 AVTQDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 127 AVTQDWEPVVLHKSKPK+ +LRDPKAVNQALRSG PVQT+KK Sbjct: 8 AVTQDWEPVVLHKSKPKAQELRDPKAVNQALRSGPPVQTIKK 49 >ref|XP_006298630.1| hypothetical protein CARUB_v10014716mg [Capsella rubella] gi|482567339|gb|EOA31528.1| hypothetical protein CARUB_v10014716mg [Capsella rubella] Length = 190 Score = 80.5 bits (197), Expect = 8e-13 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = +2 Query: 2 AVTQDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 127 AVTQDWEPVVLHKSKPKS DLRDPKAVN ALRSGV VQTVKK Sbjct: 50 AVTQDWEPVVLHKSKPKSQDLRDPKAVNAALRSGVAVQTVKK 91 >ref|XP_007202731.1| hypothetical protein PRUPE_ppa013016mg [Prunus persica] gi|462398262|gb|EMJ03930.1| hypothetical protein PRUPE_ppa013016mg [Prunus persica] Length = 144 Score = 78.2 bits (191), Expect = 4e-12 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +2 Query: 5 VTQDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 127 +TQDWEPVV+HKS+PK DLRDPKAVNQALRSG P+QT+KK Sbjct: 9 ITQDWEPVVIHKSRPKGQDLRDPKAVNQALRSGAPIQTIKK 49 >ref|XP_006418740.1| hypothetical protein EUTSA_v10002703mg [Eutrema salsugineum] gi|557096668|gb|ESQ37176.1| hypothetical protein EUTSA_v10002703mg [Eutrema salsugineum] Length = 148 Score = 77.4 bits (189), Expect = 6e-12 Identities = 38/42 (90%), Positives = 38/42 (90%) Frame = +2 Query: 2 AVTQDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 127 AVTQDWEPVVLHKSK KS DLRDPKAVN ALRSGV VQTVKK Sbjct: 8 AVTQDWEPVVLHKSKQKSQDLRDPKAVNAALRSGVAVQTVKK 49 >ref|NP_189093.1| multiprotein-bridging factor 1c [Arabidopsis thaliana] gi|75274343|sp|Q9LV58.1|MBF1C_ARATH RecName: Full=Multiprotein-bridging factor 1c gi|9294040|dbj|BAB01997.1| ethylene-responsive transcriptional coactivator-like protein [Arabidopsis thaliana] gi|28466837|gb|AAO44027.1| At3g24500 [Arabidopsis thaliana] gi|110735899|dbj|BAE99925.1| putative ethylene-responsive transcriptional coactivator [Arabidopsis thaliana] gi|332643384|gb|AEE76905.1| multiprotein-bridging factor 1c [Arabidopsis thaliana] Length = 148 Score = 76.3 bits (186), Expect = 1e-11 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = +2 Query: 2 AVTQDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 127 AVTQDWEPVVLHKSK KS DLRDPKAVN ALR+GV VQTVKK Sbjct: 8 AVTQDWEPVVLHKSKQKSQDLRDPKAVNAALRNGVAVQTVKK 49 >ref|NP_001189962.1| multiprotein-bridging factor 1c [Arabidopsis thaliana] gi|332643385|gb|AEE76906.1| multiprotein-bridging factor 1c [Arabidopsis thaliana] Length = 97 Score = 76.3 bits (186), Expect = 1e-11 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = +2 Query: 2 AVTQDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 127 AVTQDWEPVVLHKSK KS DLRDPKAVN ALR+GV VQTVKK Sbjct: 8 AVTQDWEPVVLHKSKQKSQDLRDPKAVNAALRNGVAVQTVKK 49 >gb|AAM62814.1| ethylene-responsive transcriptional coactivator, putative [Arabidopsis thaliana] Length = 148 Score = 76.3 bits (186), Expect = 1e-11 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = +2 Query: 2 AVTQDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 127 AVTQDWEPVVLHKSK KS DLRDPKAVN ALR+GV VQTVKK Sbjct: 8 AVTQDWEPVVLHKSKQKSQDLRDPKAVNAALRNGVAVQTVKK 49 >ref|XP_002883523.1| ATMBF1C/MBF1C [Arabidopsis lyrata subsp. lyrata] gi|297329363|gb|EFH59782.1| ATMBF1C/MBF1C [Arabidopsis lyrata subsp. lyrata] Length = 148 Score = 75.9 bits (185), Expect = 2e-11 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +2 Query: 2 AVTQDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 127 AVTQDWEPV+LHKSK KS DLRDPKAVN ALR+GV VQTVKK Sbjct: 8 AVTQDWEPVILHKSKQKSQDLRDPKAVNAALRNGVAVQTVKK 49 >ref|XP_004139340.1| PREDICTED: multiprotein-bridging factor 1c-like [Cucumis sativus] gi|449521076|ref|XP_004167557.1| PREDICTED: multiprotein-bridging factor 1c-like [Cucumis sativus] Length = 145 Score = 75.5 bits (184), Expect = 2e-11 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +2 Query: 2 AVTQDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 127 A++QDWEPVVLHK+KPK+ LRDPKAVNQA+RSG PVQTVKK Sbjct: 8 ALSQDWEPVVLHKAKPKAQALRDPKAVNQAIRSGAPVQTVKK 49 >ref|XP_002284605.1| PREDICTED: multiprotein-bridging factor 1c [Vitis vinifera] Length = 144 Score = 75.5 bits (184), Expect = 2e-11 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = +2 Query: 2 AVTQDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 127 A++QDWEPVVLHKSKPK+ +LRDPKAVN+A+RSG PVQT+KK Sbjct: 8 ALSQDWEPVVLHKSKPKAQELRDPKAVNKAIRSGAPVQTLKK 49 >emb|CAN79519.1| hypothetical protein VITISV_034625 [Vitis vinifera] Length = 144 Score = 75.5 bits (184), Expect = 2e-11 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = +2 Query: 2 AVTQDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 127 A++QDWEPVVLHKSKPK+ +LRDPKAVN+A+RSG PVQT+KK Sbjct: 8 ALSQDWEPVVLHKSKPKAQELRDPKAVNKAIRSGAPVQTLKK 49 >gb|EXB37038.1| Multiprotein-bridging factor 1c [Morus notabilis] Length = 147 Score = 75.1 bits (183), Expect = 3e-11 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +2 Query: 2 AVTQDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 127 A+TQDWEPVV+HKSKPK+ LRDPKAVNQALRSG VQTVKK Sbjct: 8 AITQDWEPVVVHKSKPKAQALRDPKAVNQALRSGAGVQTVKK 49 >gb|EXB37036.1| Multiprotein-bridging factor 1c [Morus notabilis] Length = 147 Score = 75.1 bits (183), Expect = 3e-11 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +2 Query: 2 AVTQDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 127 A+TQDWEPVV+HKSKPK+ LRDPKAVNQALRSG VQTVKK Sbjct: 8 AITQDWEPVVVHKSKPKAQALRDPKAVNQALRSGAGVQTVKK 49 >ref|XP_002324409.1| ethylene-responsive transcriptional coactivator family protein [Populus trichocarpa] gi|222865843|gb|EEF02974.1| ethylene-responsive transcriptional coactivator family protein [Populus trichocarpa] Length = 145 Score = 74.3 bits (181), Expect = 5e-11 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +2 Query: 5 VTQDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 127 + QDWEPVV+HK+KPKS DLRDPK VN ALRSG PVQT+KK Sbjct: 9 IKQDWEPVVMHKAKPKSQDLRDPKVVNHALRSGAPVQTIKK 49 >ref|XP_002514331.1| Multiprotein-bridging factor, putative [Ricinus communis] gi|223546787|gb|EEF48285.1| Multiprotein-bridging factor, putative [Ricinus communis] Length = 146 Score = 72.0 bits (175), Expect = 3e-10 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = +2 Query: 5 VTQDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 127 ++QDW+PVVL KSK K+ DLRDPKAVNQALRSG PVQT+KK Sbjct: 9 ISQDWDPVVLRKSKTKAQDLRDPKAVNQALRSGAPVQTIKK 49 >gb|AGQ57014.1| ethylene-responsive transcriptional coactivator [Hevea brasiliensis] Length = 144 Score = 71.6 bits (174), Expect = 4e-10 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = +2 Query: 5 VTQDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 127 ++QDWEPVVL KSK K+ DLRDPKAVNQALRSGVPVQ ++K Sbjct: 9 ISQDWEPVVLRKSKTKAQDLRDPKAVNQALRSGVPVQAIRK 49 >ref|XP_007152816.1| hypothetical protein PHAVU_004G162100g [Phaseolus vulgaris] gi|561026125|gb|ESW24810.1| hypothetical protein PHAVU_004G162100g [Phaseolus vulgaris] Length = 145 Score = 71.2 bits (173), Expect = 5e-10 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +2 Query: 2 AVTQDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 127 A+TQDW+P+VLH++KPK+ DLR+PKAVNQALRSG V TVKK Sbjct: 8 AITQDWDPIVLHRAKPKAQDLRNPKAVNQALRSGAEVLTVKK 49 >ref|XP_004512966.1| PREDICTED: multiprotein-bridging factor 1c-like [Cicer arietinum] Length = 145 Score = 71.2 bits (173), Expect = 5e-10 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = +2 Query: 2 AVTQDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 127 A+ QDWEP+VLHKSKPK+ DLR+PKAVNQALR+G + TVKK Sbjct: 8 AIAQDWEPIVLHKSKPKAQDLRNPKAVNQALRTGAEILTVKK 49 >gb|AAL32037.2|AF439278_1 ethylene-responsive transciptional coactivator-like protein [Retama raetam] Length = 145 Score = 69.3 bits (168), Expect = 2e-09 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = +2 Query: 5 VTQDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 127 +TQDWE VVLHKSKPK+ DLR+PKA++QALR+G VQT+KK Sbjct: 9 ITQDWETVVLHKSKPKAQDLRNPKAISQALRAGAEVQTIKK 49