BLASTX nr result
ID: Paeonia24_contig00019032
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00019032 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB09923.1| copia-like retrotransposable element [Arabidopsi... 49 3e-08 >dbj|BAB09923.1| copia-like retrotransposable element [Arabidopsis thaliana] Length = 1342 Score = 48.5 bits (114), Expect(3) = 3e-08 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +3 Query: 147 IQLKVEYGSTIVLKDVWYVPTLKKNLTSLGGLESKGLW 260 +++K E GSTI+L DV Y+P + KNL SLG LE KG W Sbjct: 356 VRIKNEDGSTILLTDVRYIPEMSKNLISLGTLEDKGCW 393 Score = 29.6 bits (65), Expect(3) = 3e-08 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 Query: 59 KDWFSDLKTNVDEQVLMGNGIACEVE*IGD 148 KDW D K +V MGN EV+ IGD Sbjct: 326 KDWIIDFKETASGKVRMGNDTYSEVKGIGD 355 Score = 24.6 bits (52), Expect(3) = 3e-08 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +1 Query: 19 WILDSTCSFHV 51 WILD+ CSFH+ Sbjct: 312 WILDTGCSFHM 322