BLASTX nr result
ID: Paeonia24_contig00017819
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00017819 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC58827.1| hypothetical protein L484_001250 [Morus notabilis] 56 6e-06 ref|NP_850478.1| Zn finger protein RED AND FAR-RED INSENSITIVE 2... 56 6e-06 ref|XP_002882128.1| zinc finger family protein [Arabidopsis lyra... 56 6e-06 >gb|EXC58827.1| hypothetical protein L484_001250 [Morus notabilis] Length = 445 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = +3 Query: 3 IGSAFNMSGVMRCPNCRRSENGDWRYANGDPNPY 104 IGSAFNM G M+CPNCR+ ENG W YANG + Sbjct: 43 IGSAFNMKGAMQCPNCRKVENGQWLYANGSTRSF 76 >ref|NP_850478.1| Zn finger protein RED AND FAR-RED INSENSITIVE 2 [Arabidopsis thaliana] gi|20197309|gb|AAC63626.2| unknown protein [Arabidopsis thaliana] gi|27311613|gb|AAO00772.1| unknown protein [Arabidopsis thaliana] gi|31711856|gb|AAP68284.1| At2g47700 [Arabidopsis thaliana] gi|70905099|gb|AAZ14075.1| At2g47700 [Arabidopsis thaliana] gi|330255784|gb|AEC10878.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Length = 358 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = +3 Query: 3 IGSAFNMSGVMRCPNCRRSENGDWRYANGDPNPY 104 IGSAFNM G M+CPNCR E G W YANG P+ Sbjct: 67 IGSAFNMKGAMQCPNCRNVEKGQWLYANGSTRPF 100 >ref|XP_002882128.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297327967|gb|EFH58387.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Length = 351 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = +3 Query: 3 IGSAFNMSGVMRCPNCRRSENGDWRYANGDPNPY 104 IGSAFNM G M+CPNCR E G W YANG P+ Sbjct: 67 IGSAFNMKGAMQCPNCRNVEKGQWLYANGSTRPF 100