BLASTX nr result
ID: Paeonia24_contig00017357
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00017357 (286 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015340.1| Cyclin B1, putative [Theobroma cacao] gi|508... 56 6e-06 >ref|XP_007015340.1| Cyclin B1, putative [Theobroma cacao] gi|508785703|gb|EOY32959.1| Cyclin B1, putative [Theobroma cacao] Length = 416 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -1 Query: 286 KLLVSFHSAASVSELKAVLGKFSSPAHGSVALLTPAKSLLLN 161 KLLV FH+ A+ S+LKAV KFSSP G+VALL+PAKSLL N Sbjct: 371 KLLVKFHATAAESKLKAVYRKFSSPDRGAVALLSPAKSLLPN 412