BLASTX nr result
ID: Paeonia24_contig00017348
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00017348 (447 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007033337.1| Proteasome maturation factor UMP1 [Theobroma... 72 8e-11 gb|AAC32158.1| hypothetical protein [Picea mariana] 70 3e-10 gb|AFK46972.1| unknown [Lotus japonicus] 70 4e-10 ref|XP_004511459.1| PREDICTED: cyclin-B1-2-like [Cicer arietinum] 69 5e-10 ref|XP_004156232.1| PREDICTED: proteasome maturation protein hom... 69 5e-10 ref|XP_004141496.1| PREDICTED: cyclin-B1-2-like [Cucumis sativus] 69 5e-10 gb|AAF02452.1|AF127435_1 unknown [Picea abies] gi|6049100|gb|AAF... 69 7e-10 gb|AAC32157.1| hypothetical protein [Picea mariana] gi|2996134|g... 69 7e-10 gb|AAC32110.1| hypothetical protein [Picea mariana] 69 7e-10 gb|ABK21214.1| unknown [Picea sitchensis] 69 7e-10 ref|XP_006338279.1| PREDICTED: cyclin-B1-2-like [Solanum tuberosum] 67 2e-09 ref|XP_004233649.1| PREDICTED: cyclin-B1-2-like [Solanum lycoper... 67 2e-09 ref|XP_002525964.1| Proteasome maturation protein, putative [Ric... 66 4e-09 gb|AAC32156.1| hypothetical protein [Picea mariana] 66 6e-09 ref|XP_006373461.1| proteasome maturation factor UMP1 family pro... 66 6e-09 ref|XP_002308643.1| proteasome maturation factor UMP1 family pro... 66 6e-09 gb|ABK92694.1| unknown [Populus trichocarpa] 66 6e-09 gb|EYU39374.1| hypothetical protein MIMGU_mgv1a015968mg [Mimulus... 65 1e-08 ref|XP_006405732.1| hypothetical protein EUTSA_v10027984mg [Eutr... 65 1e-08 ref|XP_006842692.1| hypothetical protein AMTR_s00147p00071690 [A... 65 1e-08 >ref|XP_007033337.1| Proteasome maturation factor UMP1 [Theobroma cacao] gi|508712366|gb|EOY04263.1| Proteasome maturation factor UMP1 [Theobroma cacao] Length = 217 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +1 Query: 1 DYLNDPRESETVRPADLHHGMEVNLGLSKGPVCSTFI 111 DYLNDPRESETVRP DLHH MEV+LGLSKGPVC +FI Sbjct: 181 DYLNDPRESETVRPLDLHHNMEVHLGLSKGPVCPSFI 217 >gb|AAC32158.1| hypothetical protein [Picea mariana] Length = 46 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +1 Query: 1 DYLNDPRESETVRPADLHHGMEVNLGLSKGPVCSTFI 111 DYLNDPRESET PAD+HHGMEV LGLSKGPVC +FI Sbjct: 10 DYLNDPRESETFVPADMHHGMEVRLGLSKGPVCRSFI 46 >gb|AFK46972.1| unknown [Lotus japonicus] Length = 142 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +1 Query: 1 DYLNDPRESETVRPADLHHGMEVNLGLSKGPVCSTFI 111 DYL+DPRESET+RP D+HHGMEV LGLSKGPVC +F+ Sbjct: 106 DYLSDPRESETIRPLDMHHGMEVRLGLSKGPVCPSFM 142 >ref|XP_004511459.1| PREDICTED: cyclin-B1-2-like [Cicer arietinum] Length = 142 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +1 Query: 1 DYLNDPRESETVRPADLHHGMEVNLGLSKGPVCSTFI 111 DYLNDPRESET+RP D+H+GMEV LGLSKGPVC +FI Sbjct: 106 DYLNDPRESETLRPLDMHNGMEVRLGLSKGPVCPSFI 142 >ref|XP_004156232.1| PREDICTED: proteasome maturation protein homolog [Cucumis sativus] Length = 93 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +1 Query: 1 DYLNDPRESETVRPADLHHGMEVNLGLSKGPVCSTFI 111 DYLNDPRESE++RP D+HHGMEV LGLSKGPVC +F+ Sbjct: 57 DYLNDPRESESLRPLDMHHGMEVRLGLSKGPVCPSFM 93 >ref|XP_004141496.1| PREDICTED: cyclin-B1-2-like [Cucumis sativus] Length = 141 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +1 Query: 1 DYLNDPRESETVRPADLHHGMEVNLGLSKGPVCSTFI 111 DYLNDPRESE++RP D+HHGMEV LGLSKGPVC +F+ Sbjct: 105 DYLNDPRESESLRPLDMHHGMEVRLGLSKGPVCPSFM 141 >gb|AAF02452.1|AF127435_1 unknown [Picea abies] gi|6049100|gb|AAF02453.1|AF127436_1 unknown [Picea abies] Length = 48 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +1 Query: 1 DYLNDPRESETVRPADLHHGMEVNLGLSKGPVCSTFI 111 DYLNDPRESET PAD+HHGMEV LGLSKGPVC +F+ Sbjct: 12 DYLNDPRESETFVPADMHHGMEVRLGLSKGPVCRSFM 48 >gb|AAC32157.1| hypothetical protein [Picea mariana] gi|2996134|gb|AAC32159.1| hypothetical protein [Picea mariana] Length = 46 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +1 Query: 1 DYLNDPRESETVRPADLHHGMEVNLGLSKGPVCSTFI 111 DYLNDPRESET PAD+HHGMEV LGLSKGPVC +F+ Sbjct: 10 DYLNDPRESETFVPADMHHGMEVRLGLSKGPVCRSFM 46 >gb|AAC32110.1| hypothetical protein [Picea mariana] Length = 141 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +1 Query: 1 DYLNDPRESETVRPADLHHGMEVNLGLSKGPVCSTFI 111 DYLNDPRESET PAD+HHGMEV LGLSKGPVC +F+ Sbjct: 105 DYLNDPRESETFVPADMHHGMEVRLGLSKGPVCRSFM 141 >gb|ABK21214.1| unknown [Picea sitchensis] Length = 141 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +1 Query: 1 DYLNDPRESETVRPADLHHGMEVNLGLSKGPVCSTFI 111 DYLNDPRESET PAD+HHGMEV LGLSKGPVC +F+ Sbjct: 105 DYLNDPRESETFVPADMHHGMEVRLGLSKGPVCRSFM 141 >ref|XP_006338279.1| PREDICTED: cyclin-B1-2-like [Solanum tuberosum] Length = 141 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 1 DYLNDPRESETVRPADLHHGMEVNLGLSKGPVCSTFI 111 DYLNDP+ESE+ RP D+HHG+EV LGLSKGPVC +FI Sbjct: 105 DYLNDPKESESFRPVDMHHGVEVRLGLSKGPVCPSFI 141 >ref|XP_004233649.1| PREDICTED: cyclin-B1-2-like [Solanum lycopersicum] Length = 198 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 1 DYLNDPRESETVRPADLHHGMEVNLGLSKGPVCSTFI 111 DYLNDP+ESE+ RP D+HHG+EV LGLSKGPVC +FI Sbjct: 162 DYLNDPKESESFRPVDMHHGVEVRLGLSKGPVCPSFI 198 >ref|XP_002525964.1| Proteasome maturation protein, putative [Ricinus communis] gi|223534696|gb|EEF36388.1| Proteasome maturation protein, putative [Ricinus communis] Length = 142 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 1 DYLNDPRESETVRPADLHHGMEVNLGLSKGPVCSTFI 111 DYLNDPRESET+R D+HH MEV +GLSKGPVC +FI Sbjct: 106 DYLNDPRESETIRTPDMHHAMEVRVGLSKGPVCPSFI 142 >gb|AAC32156.1| hypothetical protein [Picea mariana] Length = 46 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +1 Query: 1 DYLNDPRESETVRPADLHHGMEVNLGLSKGPVCSTFI 111 DYLNDPRESET PAD+HHGMEV LGLSKG VC +F+ Sbjct: 10 DYLNDPRESETFVPADMHHGMEVRLGLSKGSVCRSFM 46 >ref|XP_006373461.1| proteasome maturation factor UMP1 family protein [Populus trichocarpa] gi|550320283|gb|ERP51258.1| proteasome maturation factor UMP1 family protein [Populus trichocarpa] Length = 140 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 1 DYLNDPRESETVRPADLHHGMEVNLGLSKGPVCSTFI 111 DYLNDPRESET RP D+H GMEV LGLSKGP C +F+ Sbjct: 104 DYLNDPRESETFRPVDMHSGMEVRLGLSKGPACKSFM 140 >ref|XP_002308643.1| proteasome maturation factor UMP1 family protein [Populus trichocarpa] gi|222854619|gb|EEE92166.1| proteasome maturation factor UMP1 family protein [Populus trichocarpa] Length = 140 Score = 65.9 bits (159), Expect = 6e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +1 Query: 1 DYLNDPRESETVRPADLHHGMEVNLGLSKGPVCSTFI 111 DYLNDPRESET+RP D+H GMEV LG+SKGP C +F+ Sbjct: 104 DYLNDPRESETLRPVDMHSGMEVRLGISKGPACKSFM 140 >gb|ABK92694.1| unknown [Populus trichocarpa] Length = 82 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 1 DYLNDPRESETVRPADLHHGMEVNLGLSKGPVCSTFI 111 DYLNDPRESET RP D+H GMEV LGLSKGP C +F+ Sbjct: 46 DYLNDPRESETFRPVDMHSGMEVRLGLSKGPACKSFM 82 >gb|EYU39374.1| hypothetical protein MIMGU_mgv1a015968mg [Mimulus guttatus] Length = 139 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +1 Query: 1 DYLNDPRESETVRPADLHHGMEVNLGLSKGPVCSTFI 111 DYLNDPR+SE+ RP D+HHGMEV LGLSKGP C +F+ Sbjct: 103 DYLNDPRDSESYRPIDMHHGMEVRLGLSKGPPCPSFM 139 >ref|XP_006405732.1| hypothetical protein EUTSA_v10027984mg [Eutrema salsugineum] gi|557106870|gb|ESQ47185.1| hypothetical protein EUTSA_v10027984mg [Eutrema salsugineum] Length = 141 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +1 Query: 1 DYLNDPRESETVRPADLHHGMEVNLGLSKGPVCSTFI 111 DYLNDPRESET++P D HH MEV LGLSKGP C +F+ Sbjct: 105 DYLNDPRESETLKPVDFHHAMEVRLGLSKGPPCPSFM 141 >ref|XP_006842692.1| hypothetical protein AMTR_s00147p00071690 [Amborella trichopoda] gi|548844793|gb|ERN04367.1| hypothetical protein AMTR_s00147p00071690 [Amborella trichopoda] Length = 139 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +1 Query: 1 DYLNDPRESETVRPADLHHGMEVNLGLSKGPVCSTFI 111 DYLNDPR+SE+ RP D+H+GMEV LGL+KGP+C +FI Sbjct: 103 DYLNDPRDSESFRPVDMHNGMEVRLGLAKGPICPSFI 139