BLASTX nr result
ID: Paeonia24_contig00017338
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00017338 (274 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634351.1| PREDICTED: probable NAD(P)H-dependent oxidor... 65 1e-08 ref|XP_007227211.1| hypothetical protein PRUPE_ppa018960mg [Prun... 63 5e-08 ref|XP_002270282.2| PREDICTED: probable NAD(P)H-dependent oxidor... 61 1e-07 ref|XP_004513336.1| PREDICTED: methylecgonone reductase-like [Ci... 61 2e-07 ref|XP_007222676.1| hypothetical protein PRUPE_ppa008603mg [Prun... 61 2e-07 ref|XP_004309975.1| PREDICTED: non-functional NADPH-dependent co... 60 2e-07 ref|XP_003534120.1| PREDICTED: methylecgonone reductase-like [Gl... 60 2e-07 ref|XP_002270243.1| PREDICTED: probable NAD(P)H-dependent oxidor... 60 2e-07 emb|CBI22986.3| unnamed protein product [Vitis vinifera] 60 2e-07 ref|XP_007152622.1| hypothetical protein PHAVU_004G1456001g, par... 60 3e-07 ref|XP_003631954.1| PREDICTED: LOW QUALITY PROTEIN: probable NAD... 60 3e-07 emb|CBI22984.3| unnamed protein product [Vitis vinifera] 60 3e-07 ref|XP_007044486.1| NAD(P)-linked oxidoreductase superfamily pro... 60 4e-07 ref|XP_004515230.1| PREDICTED: methylecgonone reductase-like [Ci... 60 4e-07 ref|XP_006492304.1| PREDICTED: non-functional NADPH-dependent co... 59 5e-07 ref|XP_006492288.1| PREDICTED: non-functional NADPH-dependent co... 59 5e-07 ref|XP_006492284.1| PREDICTED: non-functional NADPH-dependent co... 59 5e-07 ref|XP_006448064.1| hypothetical protein CICLE_v10017512mg [Citr... 59 5e-07 ref|XP_006448063.1| hypothetical protein CICLE_v10015868mg [Citr... 59 5e-07 ref|XP_004299494.1| PREDICTED: non-functional NADPH-dependent co... 59 5e-07 >ref|XP_003634351.1| PREDICTED: probable NAD(P)H-dependent oxidoreductase 1-like [Vitis vinifera] gi|302142242|emb|CBI19445.3| unnamed protein product [Vitis vinifera] Length = 322 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -3 Query: 269 IVKSFNKERMKQNCQIFDWELSEDELSMIKQIPQHSGLLGNV 144 +VKSFNKERMK+N QIFDWELS+DEL+ I+QIPQ G G + Sbjct: 262 LVKSFNKERMKENLQIFDWELSDDELAKIEQIPQRRGFSGQM 303 >ref|XP_007227211.1| hypothetical protein PRUPE_ppa018960mg [Prunus persica] gi|462424147|gb|EMJ28410.1| hypothetical protein PRUPE_ppa018960mg [Prunus persica] Length = 333 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -3 Query: 266 VKSFNKERMKQNCQIFDWELSEDELSMIKQIPQHSGLL 153 VKS+NKER+KQN Q+FDWELSED+L+ I QIPQH +L Sbjct: 271 VKSYNKERLKQNLQVFDWELSEDDLNKINQIPQHKMML 308 >ref|XP_002270282.2| PREDICTED: probable NAD(P)H-dependent oxidoreductase 1-like [Vitis vinifera] Length = 267 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -3 Query: 269 IVKSFNKERMKQNCQIFDWELSEDELSMIKQIPQHSGLLG 150 +V+SFNKERMK+N QIFDWEL +DEL+ I QIPQ G G Sbjct: 207 VVRSFNKERMKENLQIFDWELGDDELAKIGQIPQRRGFSG 246 >ref|XP_004513336.1| PREDICTED: methylecgonone reductase-like [Cicer arietinum] Length = 322 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/52 (59%), Positives = 36/52 (69%) Frame = -3 Query: 272 AIVKSFNKERMKQNCQIFDWELSEDELSMIKQIPQHSGLLGNVIWDISQSRC 117 A+ KSFNKERMKQN +IFD+ELSED+L IKQIPQ LG +W C Sbjct: 261 AMAKSFNKERMKQNLEIFDFELSEDDLEKIKQIPQSRQYLGE-MWLSENGSC 311 >ref|XP_007222676.1| hypothetical protein PRUPE_ppa008603mg [Prunus persica] gi|462419612|gb|EMJ23875.1| hypothetical protein PRUPE_ppa008603mg [Prunus persica] Length = 325 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 266 VKSFNKERMKQNCQIFDWELSEDELSMIKQIPQH 165 VKS+NKER+KQN Q+FDWELSED+L I QIPQH Sbjct: 266 VKSYNKERLKQNLQVFDWELSEDDLHKINQIPQH 299 >ref|XP_004309975.1| PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like [Fragaria vesca subsp. vesca] Length = 323 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 266 VKSFNKERMKQNCQIFDWELSEDELSMIKQIPQHSGLL 153 VKS+NKER+KQN Q+FDWELSE++L I QIPQH +L Sbjct: 264 VKSYNKERLKQNVQVFDWELSEEDLDKINQIPQHRMML 301 >ref|XP_003534120.1| PREDICTED: methylecgonone reductase-like [Glycine max] Length = 318 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = -3 Query: 269 IVKSFNKERMKQNCQIFDWELSEDELSMIKQIPQHSGLLG 150 IVKSFN ERMK+N ++FDWELSE + IKQIPQH G G Sbjct: 261 IVKSFNSERMKENLKLFDWELSETDSEKIKQIPQHRGFSG 300 >ref|XP_002270243.1| PREDICTED: probable NAD(P)H-dependent oxidoreductase 1-like [Vitis vinifera] Length = 396 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -3 Query: 269 IVKSFNKERMKQNCQIFDWELSEDELSMIKQIPQHSGLLG 150 +VKSFNKERMK+N +IFDWEL+++EL+ IKQI QH G G Sbjct: 336 VVKSFNKERMKENLKIFDWELTDNELAKIKQILQHRGCPG 375 >emb|CBI22986.3| unnamed protein product [Vitis vinifera] Length = 318 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -3 Query: 269 IVKSFNKERMKQNCQIFDWELSEDELSMIKQIPQHSGLLG 150 +VKSFNKERMK+N +IFDWEL+++EL+ IKQI QH G G Sbjct: 258 VVKSFNKERMKENLKIFDWELTDNELAKIKQILQHRGCPG 297 >ref|XP_007152622.1| hypothetical protein PHAVU_004G1456001g, partial [Phaseolus vulgaris] gi|561025931|gb|ESW24616.1| hypothetical protein PHAVU_004G1456001g, partial [Phaseolus vulgaris] Length = 71 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = -3 Query: 269 IVKSFNKERMKQNCQIFDWELSEDELSMIKQIPQHSGLLG 150 IVKSFN ERMKQN QIFDWELSE + IK+I QH G G Sbjct: 14 IVKSFNSERMKQNLQIFDWELSESDSEKIKEIAQHRGFKG 53 >ref|XP_003631954.1| PREDICTED: LOW QUALITY PROTEIN: probable NAD(P)H-dependent oxidoreductase 1-like [Vitis vinifera] Length = 322 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -3 Query: 269 IVKSFNKERMKQNCQIFDWELSEDELSMIKQIPQHSGLLGN 147 +VKSF+KERMK+N QIFDWEL++DEL+ I+ IPQ G G+ Sbjct: 262 LVKSFSKERMKENLQIFDWELNDDELTKIENIPQRRGFSGH 302 >emb|CBI22984.3| unnamed protein product [Vitis vinifera] Length = 245 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -3 Query: 269 IVKSFNKERMKQNCQIFDWELSEDELSMIKQIPQHSGLLGN 147 +VKSF+KERMK+N QIFDWEL++DEL+ I+ IPQ G G+ Sbjct: 185 LVKSFSKERMKENLQIFDWELNDDELTKIENIPQRRGFSGH 225 >ref|XP_007044486.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao] gi|508708421|gb|EOY00318.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao] Length = 328 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -3 Query: 269 IVKSFNKERMKQNCQIFDWELSEDELSMIKQIPQHSGLLG 150 IVKSFN ERMKQN +IFDW L+EDEL+ I +IPQ G+ G Sbjct: 268 IVKSFNGERMKQNLEIFDWSLNEDELNKISEIPQSRGVTG 307 >ref|XP_004515230.1| PREDICTED: methylecgonone reductase-like [Cicer arietinum] Length = 318 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -3 Query: 272 AIVKSFNKERMKQNCQIFDWELSEDELSMIKQIPQ 168 AIVKSFNKERMKQN +IFDWELS++EL I +IPQ Sbjct: 260 AIVKSFNKERMKQNLEIFDWELSQEELDKINKIPQ 294 >ref|XP_006492304.1| PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like [Citrus sinensis] Length = 323 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -3 Query: 269 IVKSFNKERMKQNCQIFDWELSEDELSMIKQIPQHSG 159 +VKSFNKERMK+N IFDWELS +EL I+QIPQ+ G Sbjct: 263 VVKSFNKERMKENLDIFDWELSAEELQKIEQIPQYRG 299 >ref|XP_006492288.1| PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like [Citrus sinensis] Length = 335 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -3 Query: 269 IVKSFNKERMKQNCQIFDWELSEDELSMIKQIPQHSG 159 +VKSFNKERMK+N IFDWELS +EL I+QIPQ+ G Sbjct: 275 VVKSFNKERMKENLDIFDWELSAEELQKIEQIPQYRG 311 >ref|XP_006492284.1| PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like [Citrus sinensis] Length = 318 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -3 Query: 269 IVKSFNKERMKQNCQIFDWELSEDELSMIKQIPQHSG 159 IVKSFNKERM+QN IFDWELS +EL I+QIPQ+ G Sbjct: 258 IVKSFNKERMEQNIDIFDWELSAEELQKIEQIPQYRG 294 >ref|XP_006448064.1| hypothetical protein CICLE_v10017512mg [Citrus clementina] gi|557550675|gb|ESR61304.1| hypothetical protein CICLE_v10017512mg [Citrus clementina] Length = 325 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -3 Query: 269 IVKSFNKERMKQNCQIFDWELSEDELSMIKQIPQHSG 159 +VKSFNKERMK+N IFDWELS +EL I+QIPQ+ G Sbjct: 265 VVKSFNKERMKENLDIFDWELSAEELQKIEQIPQYRG 301 >ref|XP_006448063.1| hypothetical protein CICLE_v10015868mg [Citrus clementina] gi|557550674|gb|ESR61303.1| hypothetical protein CICLE_v10015868mg [Citrus clementina] Length = 335 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -3 Query: 269 IVKSFNKERMKQNCQIFDWELSEDELSMIKQIPQHSG 159 +VKSFNKERMK+N IFDWELS +EL I+QIPQ+ G Sbjct: 275 VVKSFNKERMKENLDIFDWELSAEELQKIEQIPQYRG 311 >ref|XP_004299494.1| PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like [Fragaria vesca subsp. vesca] Length = 329 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -3 Query: 272 AIVKSFNKERMKQNCQIFDWELSEDELSMIKQIPQ 168 AI +SFNKERMK N QIFDWEL+EDE++ IK+IPQ Sbjct: 268 AISRSFNKERMKDNAQIFDWELTEDEMNKIKEIPQ 302