BLASTX nr result
ID: Paeonia24_contig00015809
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00015809 (366 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272860.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 emb|CAN75780.1| hypothetical protein VITISV_012424 [Vitis vinifera] 74 3e-11 ref|XP_007023627.1| Pentatricopeptide repeat-containing protein,... 58 2e-06 >ref|XP_002272860.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61360 [Vitis vinifera] gi|296081020|emb|CBI18524.3| unnamed protein product [Vitis vinifera] Length = 513 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/60 (58%), Positives = 45/60 (75%) Frame = -3 Query: 181 MKPNRSNQLIEIPSKLTSFLAIAFKSSWPSHQSIESKHEIEQITRIISEAPFPEHPLQHT 2 ++ RSNQ +IP KLT FL IAFKSS SH S+E K EI+++TRII++ PFP+HPL T Sbjct: 4 LRTKRSNQPYQIPQKLTLFLNIAFKSSGQSHPSLEIKSEIDRVTRIINDHPFPDHPLHST 63 >emb|CAN75780.1| hypothetical protein VITISV_012424 [Vitis vinifera] Length = 515 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/60 (58%), Positives = 45/60 (75%) Frame = -3 Query: 181 MKPNRSNQLIEIPSKLTSFLAIAFKSSWPSHQSIESKHEIEQITRIISEAPFPEHPLQHT 2 ++ RSNQ +IP KLT FL IAFKSS SH S+E K EI+++TRII++ PFP+HPL T Sbjct: 4 LRTKRSNQPYQIPQKLTLFLNIAFKSSGQSHPSLEIKSEIDRVTRIINDHPFPDHPLHST 63 >ref|XP_007023627.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508778993|gb|EOY26249.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 512 Score = 57.8 bits (138), Expect = 2e-06 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 1/61 (1%) Frame = -3 Query: 181 MKPNRSNQLIEIP-SKLTSFLAIAFKSSWPSHQSIESKHEIEQITRIISEAPFPEHPLQH 5 +K S+QLI+IP + L+ FL++A KSS S S E K EIE+ITRII++ PFP+ PLQ Sbjct: 5 LKMKGSSQLIQIPKANLSLFLSVASKSSSSSPLSSEIKTEIERITRIINDHPFPDEPLQP 64 Query: 4 T 2 T Sbjct: 65 T 65