BLASTX nr result
ID: Paeonia24_contig00014948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00014948 (638 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271403.1| PREDICTED: uncharacterized protein LOC100259... 76 1e-11 emb|CAN60871.1| hypothetical protein VITISV_016379 [Vitis vinifera] 73 6e-11 ref|XP_002532992.1| nucleic acid binding protein, putative [Rici... 61 2e-07 ref|XP_007026942.1| Zinc-finger protein 10, putative [Theobroma ... 60 6e-07 ref|XP_002323520.1| RABBIT EARS family protein [Populus trichoca... 59 1e-06 >ref|XP_002271403.1| PREDICTED: uncharacterized protein LOC100259726 [Vitis vinifera] Length = 303 Score = 75.9 bits (185), Expect = 1e-11 Identities = 53/110 (48%), Positives = 58/110 (52%), Gaps = 8/110 (7%) Frame = +3 Query: 3 DLKADGEKKARIFEPDGCRAKKDYSCTKPDLSVSLNLVLCGKEEAASS--------LKRR 158 D KA+GEK +RI E GC AK DY KPDLSVSLN V+ + ASS KRR Sbjct: 197 DPKAEGEKSSRILE-SGCWAKGDY--IKPDLSVSLNWVVRRTRQTASSGGMEETISCKRR 253 Query: 159 RADHHASPLPFFKKPSTSDRHHVGPEVXXXXXXXXXXXXXXXXXXHRPKV 308 R D S LPFF KPS+ DRHHV PEV RPKV Sbjct: 254 RTDS-PSLLPFFLKPSSGDRHHVQPEVLELRASSLEDLDLELRLGERPKV 302 >emb|CAN60871.1| hypothetical protein VITISV_016379 [Vitis vinifera] Length = 297 Score = 73.2 bits (178), Expect = 6e-11 Identities = 48/87 (55%), Positives = 54/87 (62%), Gaps = 8/87 (9%) Frame = +3 Query: 3 DLKADGEKKARIFEPDGCRAKKDYSCTKPDLSVSLNLVLCGKEEAASS--------LKRR 158 D KA+G+K +RI E GC AK DY KPDLSVSLN V+ + ASS KRR Sbjct: 197 DPKAEGKKSSRILE-SGCWAKGDY--IKPDLSVSLNWVVRRTRQTASSGGMEETISCKRR 253 Query: 159 RADHHASPLPFFKKPSTSDRHHVGPEV 239 R D S LPFF KPS+ DRHHV PEV Sbjct: 254 RTDS-PSLLPFFLKPSSGDRHHVQPEV 279 >ref|XP_002532992.1| nucleic acid binding protein, putative [Ricinus communis] gi|223527221|gb|EEF29384.1| nucleic acid binding protein, putative [Ricinus communis] Length = 349 Score = 61.2 bits (147), Expect = 2e-07 Identities = 42/91 (46%), Positives = 50/91 (54%), Gaps = 12/91 (13%) Frame = +3 Query: 3 DLKADGEKKARIFEPDGCRAKKDYSCTKPDLSVSLNLVL------------CGKEEAASS 146 D +++G+ K I E GCRAK DY K DL+VSLNLV+ G EE A Sbjct: 211 DPRSEGDHKDSILE-SGCRAKVDY--VKTDLAVSLNLVVRRTRQAISDDDEAGDEETAIG 267 Query: 147 LKRRRADHHASPLPFFKKPSTSDRHHVGPEV 239 KRRR S L FFKK ++ DRHHV EV Sbjct: 268 CKRRRTS--TSSLSFFKKSNSVDRHHVQSEV 296 >ref|XP_007026942.1| Zinc-finger protein 10, putative [Theobroma cacao] gi|508715547|gb|EOY07444.1| Zinc-finger protein 10, putative [Theobroma cacao] Length = 305 Score = 60.1 bits (144), Expect = 6e-07 Identities = 38/84 (45%), Positives = 46/84 (54%), Gaps = 7/84 (8%) Frame = +3 Query: 3 DLKADGEKKARIFEPDGCRAKKDYSCTKPDLSVSLNLVL-------CGKEEAASSLKRRR 161 DL +GEK RI E GC+ K DY T D+SVSLNLV+ G E KR+R Sbjct: 200 DLSTEGEKSPRILE-SGCKVKADYVQT--DMSVSLNLVVRRARPTTSGSREETVGCKRKR 256 Query: 162 ADHHASPLPFFKKPSTSDRHHVGP 233 D LPFF KP + +RHH+ P Sbjct: 257 TD--TPTLPFFLKPISIERHHLQP 278 >ref|XP_002323520.1| RABBIT EARS family protein [Populus trichocarpa] gi|222868150|gb|EEF05281.1| RABBIT EARS family protein [Populus trichocarpa] Length = 300 Score = 58.9 bits (141), Expect = 1e-06 Identities = 46/110 (41%), Positives = 55/110 (50%), Gaps = 9/110 (8%) Frame = +3 Query: 6 LKADGEKKARIFEPDGCRAKKDYSCTKPDLSVSLNLVL---------CGKEEAASSLKRR 158 L +GE+ +R E GCRAK DY T DLSVSLNLV+ CG+E S K+R Sbjct: 197 LSTEGEQNSRKIE-SGCRAKVDYVQT--DLSVSLNLVVRRTRPSISDCGEEPM--SCKKR 251 Query: 159 RADHHASPLPFFKKPSTSDRHHVGPEVXXXXXXXXXXXXXXXXXXHRPKV 308 R D S LPFF K ++ D+HHV EV RPKV Sbjct: 252 RIDK--SSLPFFLKCNSVDKHHVQSEVFEISPCTVDELDLELRLGDRPKV 299