BLASTX nr result
ID: Paeonia24_contig00014483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00014483 (428 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006421544.1| hypothetical protein CICLE_v10006867mg [Citr... 55 1e-05 >ref|XP_006421544.1| hypothetical protein CICLE_v10006867mg [Citrus clementina] gi|557523417|gb|ESR34784.1| hypothetical protein CICLE_v10006867mg [Citrus clementina] Length = 407 Score = 55.1 bits (131), Expect = 1e-05 Identities = 36/144 (25%), Positives = 67/144 (46%), Gaps = 6/144 (4%) Frame = +1 Query: 1 CNGLLLYFLSDGFFCVSNPTLKKFQLLESPRARDGFA----SASIIFDGSSQEHYKVM-C 165 CNGLLL G + + NP+ +++LL P G + ++ FD S +YKV+ Sbjct: 128 CNGLLLCSGGHGNYYICNPSTNQYRLLPQPPVGGGVSRSILGVNLAFDPSKSSYYKVVYV 187 Query: 166 NFWDKHNPTTIKCYLYNSESQDWSDHEARIVNPSAVPKN-GLYWFPYTILSRGKFIYRRS 342 D + +Y+SE+ DW + + PS + N G++W G + S Sbjct: 188 GACDSFLDGQLHMEIYSSETGDWRLYGGTLPAPSGINFNTGVFW-------NGAINWESS 240 Query: 343 NRTMVVYNFERQVFKVVKLPVAPE 414 + T + ++ +++ K + +P P+ Sbjct: 241 SETSLYFDVDKEKVKEMPMPPIPD 264