BLASTX nr result
ID: Paeonia24_contig00014455
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00014455 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007202224.1| hypothetical protein PRUPE_ppa008558mg [Prun... 64 2e-08 ref|XP_002307261.1| hypothetical protein POPTR_0005s18090g [Popu... 64 3e-08 ref|XP_002310730.2| hypothetical protein POPTR_0007s11170g [Popu... 63 5e-08 ref|XP_006380709.1| hypothetical protein POPTR_0007s11170g [Popu... 63 5e-08 ref|XP_006380708.1| hypothetical protein POPTR_0007s11170g [Popu... 63 5e-08 ref|XP_002523562.1| hypothetical protein RCOM_1407360 [Ricinus c... 62 1e-07 gb|EXB55909.1| B3 domain-containing protein [Morus notabilis] 61 1e-07 ref|XP_004289224.1| PREDICTED: B3 domain-containing protein Os01... 61 1e-07 ref|XP_007047230.1| AP2/B3-like transcriptional factor family pr... 60 2e-07 ref|XP_007047229.1| AP2/B3-like transcriptional factor family pr... 60 2e-07 ref|XP_007047228.1| AP2/B3-like transcriptional factor family pr... 60 2e-07 ref|XP_007047227.1| AP2/B3-like transcriptional factor family pr... 60 2e-07 ref|XP_006425870.1| hypothetical protein CICLE_v10025376mg [Citr... 59 5e-07 ref|XP_006425869.1| hypothetical protein CICLE_v10025376mg [Citr... 59 5e-07 ref|XP_004148056.1| PREDICTED: B3 domain-containing protein Os01... 56 6e-06 >ref|XP_007202224.1| hypothetical protein PRUPE_ppa008558mg [Prunus persica] gi|462397755|gb|EMJ03423.1| hypothetical protein PRUPE_ppa008558mg [Prunus persica] Length = 327 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = +3 Query: 186 IVVNQLVGHSELSEDICFRYYKLCCSQNAFLHDNVVKGFNHKVL 317 I+VN L+ SEL ED+ +YYKLCCSQNAFLH+N V+G NHK++ Sbjct: 158 ILVNGLLVESELPEDVRRKYYKLCCSQNAFLHENFVEGMNHKLV 201 >ref|XP_002307261.1| hypothetical protein POPTR_0005s18090g [Populus trichocarpa] gi|222856710|gb|EEE94257.1| hypothetical protein POPTR_0005s18090g [Populus trichocarpa] Length = 456 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +3 Query: 186 IVVNQLVGHSELSEDICFRYYKLCCSQNAFLHDNVVKGFNHKVL 317 I+V+ LV SELSEDI +YYKLCC+QNAFLHDN++KG N K++ Sbjct: 287 ILVDGLVLDSELSEDIRNKYYKLCCNQNAFLHDNLIKGVNFKLI 330 >ref|XP_002310730.2| hypothetical protein POPTR_0007s11170g [Populus trichocarpa] gi|550334636|gb|EEE91180.2| hypothetical protein POPTR_0007s11170g [Populus trichocarpa] Length = 477 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +3 Query: 186 IVVNQLVGHSELSEDICFRYYKLCCSQNAFLHDNVVKGFNHKVL 317 I+V+ L+ SELSEDI +YYKLCCSQNAFLHDN++KG N K++ Sbjct: 308 ILVDGLLLDSELSEDIRNKYYKLCCSQNAFLHDNLIKGVNLKLI 351 >ref|XP_006380709.1| hypothetical protein POPTR_0007s11170g [Populus trichocarpa] gi|550334635|gb|ERP58506.1| hypothetical protein POPTR_0007s11170g [Populus trichocarpa] Length = 475 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +3 Query: 186 IVVNQLVGHSELSEDICFRYYKLCCSQNAFLHDNVVKGFNHKVL 317 I+V+ L+ SELSEDI +YYKLCCSQNAFLHDN++KG N K++ Sbjct: 306 ILVDGLLLDSELSEDIRNKYYKLCCSQNAFLHDNLIKGVNLKLI 349 >ref|XP_006380708.1| hypothetical protein POPTR_0007s11170g [Populus trichocarpa] gi|550334634|gb|ERP58505.1| hypothetical protein POPTR_0007s11170g [Populus trichocarpa] Length = 286 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +3 Query: 186 IVVNQLVGHSELSEDICFRYYKLCCSQNAFLHDNVVKGFNHKVL 317 I+V+ L+ SELSEDI +YYKLCCSQNAFLHDN++KG N K++ Sbjct: 117 ILVDGLLLDSELSEDIRNKYYKLCCSQNAFLHDNLIKGVNLKLI 160 >ref|XP_002523562.1| hypothetical protein RCOM_1407360 [Ricinus communis] gi|223537124|gb|EEF38757.1| hypothetical protein RCOM_1407360 [Ricinus communis] Length = 529 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = +3 Query: 186 IVVNQLVGHSELSEDICFRYYKLCCSQNAFLHDNVVKGFNHKVL 317 I+V+ LV SELSEDI +YYKLCCSQNAFLH++++KG N K++ Sbjct: 360 ILVDGLVLDSELSEDIRRKYYKLCCSQNAFLHESLIKGINFKLI 403 >gb|EXB55909.1| B3 domain-containing protein [Morus notabilis] Length = 494 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/71 (45%), Positives = 45/71 (63%) Frame = +3 Query: 105 LRGNRSSNRIVVYRHRYESAVTLLKTLIVVNQLVGHSELSEDICFRYYKLCCSQNAFLHD 284 L G++SS + +++ T I V+ L+ SE+ EDI YYKLCCSQNAFLHD Sbjct: 301 LEGSKSSGAAI----QFQDVKTFENFSIQVDGLLLDSEVPEDIRKTYYKLCCSQNAFLHD 356 Query: 285 NVVKGFNHKVL 317 +V+KG N K++ Sbjct: 357 DVIKGMNKKLI 367 >ref|XP_004289224.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Fragaria vesca subsp. vesca] Length = 557 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = +3 Query: 186 IVVNQLVGHSELSEDICFRYYKLCCSQNAFLHDNVVKGFNHKVL 317 I+VN L+ SE EDI +YYKLCCSQNAFLH+NV+KG ++K++ Sbjct: 388 ILVNGLLVDSEFPEDIRIKYYKLCCSQNAFLHENVMKGTDYKLI 431 >ref|XP_007047230.1| AP2/B3-like transcriptional factor family protein isoform 4 [Theobroma cacao] gi|508699491|gb|EOX91387.1| AP2/B3-like transcriptional factor family protein isoform 4 [Theobroma cacao] Length = 488 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/44 (59%), Positives = 36/44 (81%) Frame = +3 Query: 186 IVVNQLVGHSELSEDICFRYYKLCCSQNAFLHDNVVKGFNHKVL 317 I+V LV SELSEDI +Y+KLCCSQN+FLH+N+++G N K++ Sbjct: 319 ILVGDLVIDSELSEDIRNKYFKLCCSQNSFLHENIIQGINFKLI 362 >ref|XP_007047229.1| AP2/B3-like transcriptional factor family protein isoform 3 [Theobroma cacao] gi|508699490|gb|EOX91386.1| AP2/B3-like transcriptional factor family protein isoform 3 [Theobroma cacao] Length = 382 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/44 (59%), Positives = 36/44 (81%) Frame = +3 Query: 186 IVVNQLVGHSELSEDICFRYYKLCCSQNAFLHDNVVKGFNHKVL 317 I+V LV SELSEDI +Y+KLCCSQN+FLH+N+++G N K++ Sbjct: 213 ILVGDLVIDSELSEDIRNKYFKLCCSQNSFLHENIIQGINFKLI 256 >ref|XP_007047228.1| AP2/B3-like transcriptional factor family protein isoform 2 [Theobroma cacao] gi|508699489|gb|EOX91385.1| AP2/B3-like transcriptional factor family protein isoform 2 [Theobroma cacao] Length = 520 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/44 (59%), Positives = 36/44 (81%) Frame = +3 Query: 186 IVVNQLVGHSELSEDICFRYYKLCCSQNAFLHDNVVKGFNHKVL 317 I+V LV SELSEDI +Y+KLCCSQN+FLH+N+++G N K++ Sbjct: 351 ILVGDLVIDSELSEDIRNKYFKLCCSQNSFLHENIIQGINFKLI 394 >ref|XP_007047227.1| AP2/B3-like transcriptional factor family protein isoform 1 [Theobroma cacao] gi|508699488|gb|EOX91384.1| AP2/B3-like transcriptional factor family protein isoform 1 [Theobroma cacao] Length = 491 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/44 (59%), Positives = 36/44 (81%) Frame = +3 Query: 186 IVVNQLVGHSELSEDICFRYYKLCCSQNAFLHDNVVKGFNHKVL 317 I+V LV SELSEDI +Y+KLCCSQN+FLH+N+++G N K++ Sbjct: 322 ILVGDLVIDSELSEDIRNKYFKLCCSQNSFLHENIIQGINFKLI 365 >ref|XP_006425870.1| hypothetical protein CICLE_v10025376mg [Citrus clementina] gi|568824465|ref|XP_006466621.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Citrus sinensis] gi|557527860|gb|ESR39110.1| hypothetical protein CICLE_v10025376mg [Citrus clementina] Length = 516 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/56 (50%), Positives = 39/56 (69%) Frame = +3 Query: 150 RYESAVTLLKTLIVVNQLVGHSELSEDICFRYYKLCCSQNAFLHDNVVKGFNHKVL 317 +++ +L I+V+ LV SEL EDI YYKLCCSQNAFLH+N+ +G N K++ Sbjct: 335 QFKDVTSLDNFNILVDGLVVDSELPEDIRCNYYKLCCSQNAFLHENLAQGINFKLI 390 >ref|XP_006425869.1| hypothetical protein CICLE_v10025376mg [Citrus clementina] gi|557527859|gb|ESR39109.1| hypothetical protein CICLE_v10025376mg [Citrus clementina] Length = 453 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/56 (50%), Positives = 39/56 (69%) Frame = +3 Query: 150 RYESAVTLLKTLIVVNQLVGHSELSEDICFRYYKLCCSQNAFLHDNVVKGFNHKVL 317 +++ +L I+V+ LV SEL EDI YYKLCCSQNAFLH+N+ +G N K++ Sbjct: 272 QFKDVTSLDNFNILVDGLVVDSELPEDIRCNYYKLCCSQNAFLHENLAQGINFKLI 327 >ref|XP_004148056.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Cucumis sativus] gi|449502766|ref|XP_004161736.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Cucumis sativus] Length = 501 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/44 (54%), Positives = 34/44 (77%) Frame = +3 Query: 186 IVVNQLVGHSELSEDICFRYYKLCCSQNAFLHDNVVKGFNHKVL 317 IV++ L +SEL D+ RYYKLCCSQN FLH+N+++G N K++ Sbjct: 332 IVIDGLSINSELPRDLRKRYYKLCCSQNMFLHENLIQGMNRKLV 375