BLASTX nr result
ID: Paeonia24_contig00014407
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00014407 (670 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275092.2| PREDICTED: valyl-tRNA synthetase-like [Vitis... 59 1e-06 emb|CBI31848.3| unnamed protein product [Vitis vinifera] 59 1e-06 >ref|XP_002275092.2| PREDICTED: valyl-tRNA synthetase-like [Vitis vinifera] Length = 1071 Score = 59.3 bits (142), Expect = 1e-06 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 2/43 (4%) Frame = -1 Query: 124 RLQAQQAS--VSKKSERKKKLDANEENAEDYVDPNTPSGEKKQ 2 +LQAQQAS SKKSERK K DA ENAEDY+DP TP GEKK+ Sbjct: 53 KLQAQQASSNASKKSERKIKRDAEGENAEDYIDPETPFGEKKR 95 >emb|CBI31848.3| unnamed protein product [Vitis vinifera] Length = 1106 Score = 59.3 bits (142), Expect = 1e-06 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 2/43 (4%) Frame = -1 Query: 124 RLQAQQAS--VSKKSERKKKLDANEENAEDYVDPNTPSGEKKQ 2 +LQAQQAS SKKSERK K DA ENAEDY+DP TP GEKK+ Sbjct: 88 KLQAQQASSNASKKSERKIKRDAEGENAEDYIDPETPFGEKKR 130