BLASTX nr result
ID: Paeonia24_contig00012880
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00012880 (240 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307567.2| hypothetical protein POPTR_0005s22800g [Popu... 54 1e-07 ref|XP_002300861.2| hypothetical protein POPTR_0002s05700g [Popu... 54 2e-07 >ref|XP_002307567.2| hypothetical protein POPTR_0005s22800g [Populus trichocarpa] gi|550339559|gb|EEE94563.2| hypothetical protein POPTR_0005s22800g [Populus trichocarpa] Length = 915 Score = 53.5 bits (127), Expect(2) = 1e-07 Identities = 29/53 (54%), Positives = 40/53 (75%), Gaps = 1/53 (1%) Frame = -3 Query: 238 TKEVEGLSLDLPGSSKLFS-RAFKEMTRLRLLALNRQNIKGSCKHISKELKWL 83 TK VEGL L+LPG + FS +AFK+M +LRLL LN ++GS ++IS +L+WL Sbjct: 311 TKAVEGLILNLPGLKQSFSTKAFKKMKKLRLLQLNCICLEGSYEYISTKLRWL 363 Score = 28.1 bits (61), Expect(2) = 1e-07 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -1 Query: 72 DLHLENVVALDMRNSSLKVLGE 7 DL+LE ++ALDMR SSL E Sbjct: 376 DLYLETLIALDMRYSSLHQFSE 397 >ref|XP_002300861.2| hypothetical protein POPTR_0002s05700g [Populus trichocarpa] gi|550344355|gb|EEE80134.2| hypothetical protein POPTR_0002s05700g [Populus trichocarpa] Length = 979 Score = 54.3 bits (129), Expect(2) = 2e-07 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = -3 Query: 238 TKEVEGLSLDLPGSSKLFSRAFKEMTRLRLLALNRQNIKGSCKHISKELKWL 83 TK VEGL L L GS + ++AFK+M RLRLL LN ++G+ ++IS +L+WL Sbjct: 334 TKAVEGLVLSLQGSKRFNTKAFKKMKRLRLLQLNFVCLEGNYEYISNKLRWL 385 Score = 26.2 bits (56), Expect(2) = 2e-07 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -1 Query: 72 DLHLENVVALDMRNSSLKVLGE 7 DL LE+++ LDMR SSL+ E Sbjct: 398 DLTLEHLIVLDMRYSSLQQFSE 419