BLASTX nr result
ID: Paeonia24_contig00011974
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00011974 (435 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015291.1| Ankyrin repeat family protein [Theobroma cac... 57 4e-06 >ref|XP_007015291.1| Ankyrin repeat family protein [Theobroma cacao] gi|508785654|gb|EOY32910.1| Ankyrin repeat family protein [Theobroma cacao] Length = 152 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +3 Query: 333 MGMEANMSEQTPIETVQENVEALLEAARYDDIDD 434 MGMEAN EQT ET+QENVE LLEAARYDDIDD Sbjct: 1 MGMEANGVEQTSTETMQENVEELLEAARYDDIDD 34