BLASTX nr result
ID: Paeonia24_contig00011832
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00011832 (218 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006383395.1| transducin family protein [Populus trichocar... 53 3e-07 ref|XP_002271081.1| PREDICTED: WD repeat-containing protein 55 [... 47 4e-06 ref|XP_002305841.1| transducin family protein [Populus trichocar... 49 5e-06 ref|XP_002269842.1| PREDICTED: WD repeat-containing protein 55 [... 46 8e-06 emb|CAN70751.1| hypothetical protein VITISV_013206 [Vitis vinifera] 46 8e-06 >ref|XP_006383395.1| transducin family protein [Populus trichocarpa] gi|550339005|gb|ERP61192.1| transducin family protein [Populus trichocarpa] Length = 348 Score = 53.1 bits (126), Expect(2) = 3e-07 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -1 Query: 86 RLLEIHAHTESIRAVRFINDGHAILTGS 3 RLLEIHAH+ES RA RFINDGHAI+TGS Sbjct: 43 RLLEIHAHSESCRAARFINDGHAIITGS 70 Score = 26.9 bits (58), Expect(2) = 3e-07 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 216 LHLYRYAADSIPQR 175 LHLYR+ ADS PQR Sbjct: 30 LHLYRFNADSSPQR 43 >ref|XP_002271081.1| PREDICTED: WD repeat-containing protein 55 [Vitis vinifera] gi|297743547|emb|CBI36414.3| unnamed protein product [Vitis vinifera] Length = 346 Score = 47.4 bits (111), Expect(2) = 4e-06 Identities = 24/33 (72%), Positives = 27/33 (81%), Gaps = 1/33 (3%) Frame = -1 Query: 98 SFYNRLLEIHAH-TESIRAVRFINDGHAILTGS 3 S RLLE+HAH ES RAVRFIN+GHAI+TGS Sbjct: 39 SLPQRLLEVHAHGDESCRAVRFINEGHAIVTGS 71 Score = 28.9 bits (63), Expect(2) = 4e-06 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 216 LHLYRYAADSIPQR 175 LHLYRY A+S+PQR Sbjct: 30 LHLYRYGANSLPQR 43 >ref|XP_002305841.1| transducin family protein [Populus trichocarpa] gi|222848805|gb|EEE86352.1| transducin family protein [Populus trichocarpa] Length = 348 Score = 48.9 bits (115), Expect(2) = 5e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -1 Query: 86 RLLEIHAHTESIRAVRFINDGHAILTGS 3 RLLEIHAH+E+ RA RFINDG AI+TGS Sbjct: 43 RLLEIHAHSEACRAARFINDGQAIITGS 70 Score = 26.9 bits (58), Expect(2) = 5e-06 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 216 LHLYRYAADSIPQR 175 LHLYR+ ADS PQR Sbjct: 30 LHLYRFNADSSPQR 43 >ref|XP_002269842.1| PREDICTED: WD repeat-containing protein 55 [Vitis vinifera] gi|298205166|emb|CBI17225.3| unnamed protein product [Vitis vinifera] Length = 346 Score = 46.2 bits (108), Expect(2) = 8e-06 Identities = 24/33 (72%), Positives = 26/33 (78%), Gaps = 1/33 (3%) Frame = -1 Query: 98 SFYNRLLEIHAH-TESIRAVRFINDGHAILTGS 3 S RLLE+HAH ES RAVRFIN GHAI+TGS Sbjct: 39 SLPQRLLEVHAHGEESCRAVRFINKGHAIVTGS 71 Score = 28.9 bits (63), Expect(2) = 8e-06 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 216 LHLYRYAADSIPQR 175 LHLYRY A+S+PQR Sbjct: 30 LHLYRYGANSLPQR 43 >emb|CAN70751.1| hypothetical protein VITISV_013206 [Vitis vinifera] Length = 285 Score = 46.2 bits (108), Expect(2) = 8e-06 Identities = 24/33 (72%), Positives = 26/33 (78%), Gaps = 1/33 (3%) Frame = -1 Query: 98 SFYNRLLEIHAH-TESIRAVRFINDGHAILTGS 3 S RLLE+HAH ES RAVRFIN GHAI+TGS Sbjct: 39 SLPQRLLEVHAHGEESCRAVRFINKGHAIVTGS 71 Score = 28.9 bits (63), Expect(2) = 8e-06 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 216 LHLYRYAADSIPQR 175 LHLYRY A+S+PQR Sbjct: 30 LHLYRYGANSLPQR 43