BLASTX nr result
ID: Paeonia24_contig00011016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00011016 (375 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004291772.1| PREDICTED: cinnamoyl-CoA reductase 1-like [F... 78 1e-12 ref|XP_007211587.1| hypothetical protein PRUPE_ppa008618mg [Prun... 78 1e-12 dbj|BAE48658.1| Cinnamyl alcohol dehydrogenase [Prunus mume] 78 1e-12 ref|XP_007149029.1| hypothetical protein PHAVU_005G034500g [Phas... 77 2e-12 gb|AHC29025.1| phenylacetaldehyde reductase [Rosa rugosa] 76 5e-12 gb|AFY97683.1| cinnamyl alcohol dehydrogenase 1 [Pyrus pyrifolia] 76 5e-12 gb|AAC06319.1| putative cinnamyl alcohol dehydrogenase [Malus do... 76 5e-12 gb|AEN94093.1| cinnamyl alcohol dehydrogenase [Pyrus pyrifolia] 76 5e-12 ref|XP_006446146.1| hypothetical protein CICLE_v10015912mg [Citr... 75 7e-12 ref|XP_007015093.1| Cinnamyl alcohol dehydrogenase, 82967-79323,... 75 7e-12 ref|XP_007015092.1| Cinnamyl alcohol dehydrogenase, 82967-79323,... 75 7e-12 ref|XP_007015091.1| Cinnamyl alcohol dehydrogenase, 82967-79323,... 75 7e-12 gb|AFK47029.1| unknown [Lotus japonicus] 75 7e-12 ref|XP_002285368.1| PREDICTED: bifunctional dihydroflavonol 4-re... 75 7e-12 ref|XP_004491683.1| PREDICTED: cinnamoyl-CoA reductase 1-like [C... 75 1e-11 gb|ABV44810.1| cinnamyl alcohol dehydrogenase 1 [Eriobotrya japo... 75 1e-11 ref|XP_002285374.2| PREDICTED: dihydroflavonol-4-reductase [Viti... 74 2e-11 emb|CBI16354.3| unnamed protein product [Vitis vinifera] 74 2e-11 ref|XP_002263014.1| PREDICTED: dihydroflavonol-4-reductase [Viti... 74 2e-11 emb|CAN73813.1| hypothetical protein VITISV_028795 [Vitis vinifera] 74 2e-11 >ref|XP_004291772.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Fragaria vesca subsp. vesca] Length = 321 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/45 (75%), Positives = 43/45 (95%) Frame = +1 Query: 1 CGDDQPLVPTYQVSQERAKSLGIDFIPLEVSLNETVESLKEKNFL 135 C DD+PLVPTYQVS+E+AKSLGI+F+PL++SL ETVESLKEK+F+ Sbjct: 275 CSDDKPLVPTYQVSKEKAKSLGIEFVPLDISLKETVESLKEKSFI 319 >ref|XP_007211587.1| hypothetical protein PRUPE_ppa008618mg [Prunus persica] gi|462407452|gb|EMJ12786.1| hypothetical protein PRUPE_ppa008618mg [Prunus persica] Length = 325 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = +1 Query: 1 CGDDQPLVPTYQVSQERAKSLGIDFIPLEVSLNETVESLKEKNFL 135 C DD+P VPTYQVS+E+AK LG++FIPLEVSL ETVESLKEKNF+ Sbjct: 279 CADDKPFVPTYQVSKEKAKKLGVEFIPLEVSLKETVESLKEKNFV 323 >dbj|BAE48658.1| Cinnamyl alcohol dehydrogenase [Prunus mume] Length = 325 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = +1 Query: 1 CGDDQPLVPTYQVSQERAKSLGIDFIPLEVSLNETVESLKEKNFL 135 C DD+P VPTYQVS+E+AK LG++FIPLEVSL ETVESLKEKNF+ Sbjct: 279 CADDKPFVPTYQVSKEKAKKLGVEFIPLEVSLKETVESLKEKNFV 323 >ref|XP_007149029.1| hypothetical protein PHAVU_005G034500g [Phaseolus vulgaris] gi|561022293|gb|ESW21023.1| hypothetical protein PHAVU_005G034500g [Phaseolus vulgaris] Length = 329 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = +1 Query: 1 CGDDQPLVPTYQVSQERAKSLGIDFIPLEVSLNETVESLKEKNFL 135 CGDD+P VP YQVS+E+AKSLGI+FIPLEVSL ETVESLKEK F+ Sbjct: 279 CGDDKPYVPIYQVSKEKAKSLGIEFIPLEVSLKETVESLKEKKFI 323 >gb|AHC29025.1| phenylacetaldehyde reductase [Rosa rugosa] Length = 322 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/45 (73%), Positives = 42/45 (93%) Frame = +1 Query: 1 CGDDQPLVPTYQVSQERAKSLGIDFIPLEVSLNETVESLKEKNFL 135 C DD+P VPTYQVS+E+AKSLGI+FIPL++SL ET+ESLKEK+F+ Sbjct: 276 CSDDKPFVPTYQVSKEKAKSLGIEFIPLDISLKETIESLKEKSFV 320 >gb|AFY97683.1| cinnamyl alcohol dehydrogenase 1 [Pyrus pyrifolia] Length = 325 Score = 75.9 bits (185), Expect = 5e-12 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = +1 Query: 1 CGDDQPLVPTYQVSQERAKSLGIDFIPLEVSLNETVESLKEKNFL 135 C DD+P VPTYQVS+E+AKSLG++FIPL+VSL ETVESLKEK F+ Sbjct: 279 CADDKPFVPTYQVSKEKAKSLGVEFIPLDVSLKETVESLKEKGFV 323 >gb|AAC06319.1| putative cinnamyl alcohol dehydrogenase [Malus domestica] Length = 325 Score = 75.9 bits (185), Expect = 5e-12 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = +1 Query: 1 CGDDQPLVPTYQVSQERAKSLGIDFIPLEVSLNETVESLKEKNFL 135 C DD+P VPTYQVS+E+AKSLG++FIPL+VSL ETVESLKEK F+ Sbjct: 279 CADDKPFVPTYQVSKEKAKSLGVEFIPLDVSLKETVESLKEKGFV 323 >gb|AEN94093.1| cinnamyl alcohol dehydrogenase [Pyrus pyrifolia] Length = 143 Score = 75.9 bits (185), Expect = 5e-12 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = +1 Query: 1 CGDDQPLVPTYQVSQERAKSLGIDFIPLEVSLNETVESLKEKNFL 135 C DD+P VPTYQVS+E+AKSLG++FIPL+VSL ETVESLKEK F+ Sbjct: 97 CADDKPFVPTYQVSKEKAKSLGVEFIPLDVSLKETVESLKEKGFV 141 >ref|XP_006446146.1| hypothetical protein CICLE_v10015912mg [Citrus clementina] gi|568832844|ref|XP_006470636.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Citrus sinensis] gi|557548757|gb|ESR59386.1| hypothetical protein CICLE_v10015912mg [Citrus clementina] Length = 327 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = +1 Query: 1 CGDDQPLVPTYQVSQERAKSLGIDFIPLEVSLNETVESLKEKNFL 135 C DD+P VPTYQVS+E+AK+LGI+FIPLEVSL ET+ESLKEK F+ Sbjct: 281 CADDKPYVPTYQVSKEKAKNLGIEFIPLEVSLKETIESLKEKGFV 325 >ref|XP_007015093.1| Cinnamyl alcohol dehydrogenase, 82967-79323, putative isoform 3 [Theobroma cacao] gi|508785456|gb|EOY32712.1| Cinnamyl alcohol dehydrogenase, 82967-79323, putative isoform 3 [Theobroma cacao] Length = 316 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = +1 Query: 1 CGDDQPLVPTYQVSQERAKSLGIDFIPLEVSLNETVESLKEKNFL 135 C DD+P VPTYQVS+E+AK LGIDFIPL+VSL ETVESLKEK F+ Sbjct: 270 CADDKPYVPTYQVSKEKAKCLGIDFIPLDVSLKETVESLKEKGFV 314 >ref|XP_007015092.1| Cinnamyl alcohol dehydrogenase, 82967-79323, putative isoform 2 [Theobroma cacao] gi|508785455|gb|EOY32711.1| Cinnamyl alcohol dehydrogenase, 82967-79323, putative isoform 2 [Theobroma cacao] Length = 323 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = +1 Query: 1 CGDDQPLVPTYQVSQERAKSLGIDFIPLEVSLNETVESLKEKNFL 135 C DD+P VPTYQVS+E+AK LGIDFIPL+VSL ETVESLKEK F+ Sbjct: 277 CADDKPYVPTYQVSKEKAKCLGIDFIPLDVSLKETVESLKEKGFV 321 >ref|XP_007015091.1| Cinnamyl alcohol dehydrogenase, 82967-79323, putative isoform 1 [Theobroma cacao] gi|508785454|gb|EOY32710.1| Cinnamyl alcohol dehydrogenase, 82967-79323, putative isoform 1 [Theobroma cacao] Length = 325 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = +1 Query: 1 CGDDQPLVPTYQVSQERAKSLGIDFIPLEVSLNETVESLKEKNFL 135 C DD+P VPTYQVS+E+AK LGIDFIPL+VSL ETVESLKEK F+ Sbjct: 279 CADDKPYVPTYQVSKEKAKCLGIDFIPLDVSLKETVESLKEKGFV 323 >gb|AFK47029.1| unknown [Lotus japonicus] Length = 325 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = +1 Query: 1 CGDDQPLVPTYQVSQERAKSLGIDFIPLEVSLNETVESLKEKNF 132 C DD+P VPTYQVS+E+AKSLGI++IPLEVSL ETVESLKEK F Sbjct: 279 CADDKPYVPTYQVSKEKAKSLGIEYIPLEVSLKETVESLKEKKF 322 >ref|XP_002285368.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [Vitis vinifera] gi|297746297|emb|CBI16353.3| unnamed protein product [Vitis vinifera] Length = 322 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = +1 Query: 1 CGDDQPLVPTYQVSQERAKSLGIDFIPLEVSLNETVESLKEKNF 132 C DD+P VPT+QVS+E+AKSLGI+FIPLEVSL ETVESLKEK F Sbjct: 276 CADDKPFVPTFQVSKEKAKSLGIEFIPLEVSLKETVESLKEKEF 319 >ref|XP_004491683.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Cicer arietinum] Length = 325 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = +1 Query: 1 CGDDQPLVPTYQVSQERAKSLGIDFIPLEVSLNETVESLKEKNF 132 C DD+P VPTYQVS+E+AKSLGI+F PLEVSL ETVESLKEK F Sbjct: 279 CADDKPYVPTYQVSKEKAKSLGIEFTPLEVSLKETVESLKEKKF 322 >gb|ABV44810.1| cinnamyl alcohol dehydrogenase 1 [Eriobotrya japonica] Length = 305 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/45 (73%), Positives = 41/45 (91%) Frame = +1 Query: 1 CGDDQPLVPTYQVSQERAKSLGIDFIPLEVSLNETVESLKEKNFL 135 C DD+P VPTYQVS+E+AK+LG++FIPL+VSL ETVESLKEK F+ Sbjct: 259 CADDKPFVPTYQVSKEKAKNLGVEFIPLDVSLKETVESLKEKGFV 303 >ref|XP_002285374.2| PREDICTED: dihydroflavonol-4-reductase [Vitis vinifera] Length = 346 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = +1 Query: 1 CGDDQPLVPTYQVSQERAKSLGIDFIPLEVSLNETVESLKEKNFL 135 C DD P +PTYQ+S+E+AKSLGI+FIPLE SL ETVESLKEK FL Sbjct: 300 CADDHPFMPTYQISKEKAKSLGIEFIPLEESLKETVESLKEKKFL 344 >emb|CBI16354.3| unnamed protein product [Vitis vinifera] Length = 379 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = +1 Query: 1 CGDDQPLVPTYQVSQERAKSLGIDFIPLEVSLNETVESLKEKNFL 135 C DD P +PTYQ+S+E+AKSLGI+FIPLE SL ETVESLKEK FL Sbjct: 333 CADDHPFMPTYQISKEKAKSLGIEFIPLEESLKETVESLKEKKFL 377 >ref|XP_002263014.1| PREDICTED: dihydroflavonol-4-reductase [Vitis vinifera] gi|296086795|emb|CBI32944.3| unnamed protein product [Vitis vinifera] Length = 324 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = +1 Query: 1 CGDDQPLVPTYQVSQERAKSLGIDFIPLEVSLNETVESLKEKNF 132 C DD+P PTYQVSQERA+SLGI+FIP+EVS N+TVESLKEK F Sbjct: 278 CADDKPFEPTYQVSQERARSLGINFIPVEVSFNDTVESLKEKKF 321 >emb|CAN73813.1| hypothetical protein VITISV_028795 [Vitis vinifera] Length = 272 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = +1 Query: 1 CGDDQPLVPTYQVSQERAKSLGIDFIPLEVSLNETVESLKEKNF 132 C DD+P PTYQVSQERA+SLGI+FIP+EVS N+TVESLKEK F Sbjct: 226 CADDKPFEPTYQVSQERARSLGINFIPVEVSFNDTVESLKEKKF 269