BLASTX nr result
ID: Paeonia24_contig00010117
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00010117 (363 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007151521.1| hypothetical protein PHAVU_004G054000g [Phas... 55 8e-06 >ref|XP_007151521.1| hypothetical protein PHAVU_004G054000g [Phaseolus vulgaris] gi|561024830|gb|ESW23515.1| hypothetical protein PHAVU_004G054000g [Phaseolus vulgaris] Length = 450 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/48 (54%), Positives = 32/48 (66%) Frame = -2 Query: 257 KDPGIKLFGKTIPLPENQIPVMSAAGSQIPLKSELMTACNGITEVEGE 114 KDPGI+LFG+ IPLPE+QIP S G +I S M AC G+ + E E Sbjct: 4 KDPGIRLFGRKIPLPESQIPASSQMGYKIQANSATMNACGGLKKKEVE 51