BLASTX nr result
ID: Paeonia24_contig00009102
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00009102 (358 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004288534.1| PREDICTED: thioredoxin-like 1-1, chloroplast... 70 2e-10 gb|AFD98846.1| chloroplast Trx [Gossypium hirsutum] 70 2e-10 ref|XP_003548763.1| PREDICTED: thioredoxin-like 1-1, chloroplast... 70 2e-10 ref|NP_001276128.1| thioredoxin-like 1-1, chloroplastic-like [Gl... 70 2e-10 ref|XP_002525461.1| Thioredoxin, putative [Ricinus communis] gi|... 70 2e-10 gb|EXB36260.1| Thioredoxin-like 1-1 [Morus notabilis] 70 4e-10 ref|XP_003624602.1| Thioredoxin-like protein [Medicago truncatul... 69 5e-10 ref|XP_003624601.1| Thioredoxin-like protein [Medicago truncatul... 69 5e-10 ref|XP_007161960.1| hypothetical protein PHAVU_001G112200g [Phas... 68 1e-09 ref|XP_007161924.1| hypothetical protein PHAVU_001G109200g [Phas... 68 1e-09 ref|XP_006443362.1| hypothetical protein CICLE_v10021469mg [Citr... 68 1e-09 ref|XP_006443361.1| hypothetical protein CICLE_v10021469mg [Citr... 68 1e-09 ref|XP_002319706.2| thioredoxin-like 7 family protein [Populus t... 68 1e-09 ref|XP_006829786.1| hypothetical protein AMTR_s00119p00048970 [A... 68 1e-09 ref|XP_006305501.1| hypothetical protein CARUB_v10009966mg [Caps... 68 1e-09 ref|XP_007202385.1| hypothetical protein PRUPE_ppa009372mg [Prun... 68 1e-09 ref|XP_007202384.1| hypothetical protein PRUPE_ppa009372mg [Prun... 68 1e-09 ref|XP_004252003.1| PREDICTED: thioredoxin-like 1-1, chloroplast... 68 1e-09 ref|NP_172333.1| atypical CYS HIS rich thioredoxin 4 [Arabidops... 68 1e-09 gb|AFH68082.1| thioredoxin-like protein 1.2, partial [Populus tr... 68 1e-09 >ref|XP_004288534.1| PREDICTED: thioredoxin-like 1-1, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 276 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +2 Query: 248 KAMTFCGMNPDVQFLQINYEEHKSMCYSLNVHVLPFF 358 K F MNPDVQFLQ+NYEEHKSMCYSLNVHVLPFF Sbjct: 127 KICQFAEMNPDVQFLQVNYEEHKSMCYSLNVHVLPFF 163 >gb|AFD98846.1| chloroplast Trx [Gossypium hirsutum] Length = 287 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +2 Query: 248 KAMTFCGMNPDVQFLQINYEEHKSMCYSLNVHVLPFF 358 K F MNPDVQFLQ+NYEEHKSMCYSLNVHVLPFF Sbjct: 143 KICQFAEMNPDVQFLQVNYEEHKSMCYSLNVHVLPFF 179 >ref|XP_003548763.1| PREDICTED: thioredoxin-like 1-1, chloroplastic-like [Glycine max] Length = 299 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +2 Query: 248 KAMTFCGMNPDVQFLQINYEEHKSMCYSLNVHVLPFF 358 K F MNPDVQFLQ+NYEEHKSMCYSLNVHVLPFF Sbjct: 151 KICQFAEMNPDVQFLQVNYEEHKSMCYSLNVHVLPFF 187 >ref|NP_001276128.1| thioredoxin-like 1-1, chloroplastic-like [Glycine max] gi|255639909|gb|ACU20247.1| unknown [Glycine max] Length = 248 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +2 Query: 248 KAMTFCGMNPDVQFLQINYEEHKSMCYSLNVHVLPFF 358 K F MNPDVQFLQ+NYEEHKSMCYSLNVHVLPFF Sbjct: 102 KICQFAEMNPDVQFLQVNYEEHKSMCYSLNVHVLPFF 138 >ref|XP_002525461.1| Thioredoxin, putative [Ricinus communis] gi|223535274|gb|EEF36951.1| Thioredoxin, putative [Ricinus communis] Length = 296 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +2 Query: 248 KAMTFCGMNPDVQFLQINYEEHKSMCYSLNVHVLPFF 358 K F MNPDVQFLQ+NYEEHKSMCYSLNVHVLPFF Sbjct: 143 KICQFAEMNPDVQFLQVNYEEHKSMCYSLNVHVLPFF 179 >gb|EXB36260.1| Thioredoxin-like 1-1 [Morus notabilis] Length = 289 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +2 Query: 248 KAMTFCGMNPDVQFLQINYEEHKSMCYSLNVHVLPFF 358 K F MNPDVQF+Q+NYEEHKSMCYSLNVHVLPFF Sbjct: 137 KICQFAEMNPDVQFIQVNYEEHKSMCYSLNVHVLPFF 173 >ref|XP_003624602.1| Thioredoxin-like protein [Medicago truncatula] gi|355499617|gb|AES80820.1| Thioredoxin-like protein [Medicago truncatula] Length = 220 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +2 Query: 248 KAMTFCGMNPDVQFLQINYEEHKSMCYSLNVHVLPFF 358 K F MNPDV+FLQ+NYEEHKSMCYSLNVHVLPFF Sbjct: 148 KICQFAEMNPDVEFLQVNYEEHKSMCYSLNVHVLPFF 184 >ref|XP_003624601.1| Thioredoxin-like protein [Medicago truncatula] gi|124365591|gb|ABN09825.1| Thioredoxin domain 2; Thioredoxin fold [Medicago truncatula] gi|355499616|gb|AES80819.1| Thioredoxin-like protein [Medicago truncatula] gi|388494216|gb|AFK35174.1| unknown [Medicago truncatula] Length = 286 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +2 Query: 248 KAMTFCGMNPDVQFLQINYEEHKSMCYSLNVHVLPFF 358 K F MNPDV+FLQ+NYEEHKSMCYSLNVHVLPFF Sbjct: 148 KICQFAEMNPDVEFLQVNYEEHKSMCYSLNVHVLPFF 184 >ref|XP_007161960.1| hypothetical protein PHAVU_001G112200g [Phaseolus vulgaris] gi|561035424|gb|ESW33954.1| hypothetical protein PHAVU_001G112200g [Phaseolus vulgaris] Length = 292 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 269 MNPDVQFLQINYEEHKSMCYSLNVHVLPFF 358 MNPDVQFLQ+NYEEHKSMCYSLNVHVLPFF Sbjct: 154 MNPDVQFLQVNYEEHKSMCYSLNVHVLPFF 183 >ref|XP_007161924.1| hypothetical protein PHAVU_001G109200g [Phaseolus vulgaris] gi|561035388|gb|ESW33918.1| hypothetical protein PHAVU_001G109200g [Phaseolus vulgaris] Length = 291 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 269 MNPDVQFLQINYEEHKSMCYSLNVHVLPFF 358 MNPDVQFLQ+NYEEHKSMCYSLNVHVLPFF Sbjct: 154 MNPDVQFLQVNYEEHKSMCYSLNVHVLPFF 183 >ref|XP_006443362.1| hypothetical protein CICLE_v10021469mg [Citrus clementina] gi|557545624|gb|ESR56602.1| hypothetical protein CICLE_v10021469mg [Citrus clementina] Length = 203 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 269 MNPDVQFLQINYEEHKSMCYSLNVHVLPFF 358 MNPDVQFLQ+NYEEHKSMCYSLNVHVLPFF Sbjct: 147 MNPDVQFLQVNYEEHKSMCYSLNVHVLPFF 176 >ref|XP_006443361.1| hypothetical protein CICLE_v10021469mg [Citrus clementina] gi|568850755|ref|XP_006479063.1| PREDICTED: thioredoxin-like 1-1, chloroplastic-like [Citrus sinensis] gi|557545623|gb|ESR56601.1| hypothetical protein CICLE_v10021469mg [Citrus clementina] Length = 290 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 269 MNPDVQFLQINYEEHKSMCYSLNVHVLPFF 358 MNPDVQFLQ+NYEEHKSMCYSLNVHVLPFF Sbjct: 147 MNPDVQFLQVNYEEHKSMCYSLNVHVLPFF 176 >ref|XP_002319706.2| thioredoxin-like 7 family protein [Populus trichocarpa] gi|550325048|gb|EEE95629.2| thioredoxin-like 7 family protein [Populus trichocarpa] Length = 304 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 269 MNPDVQFLQINYEEHKSMCYSLNVHVLPFF 358 MNPDVQFLQ+NYEEHKSMCYSLNVHVLPFF Sbjct: 154 MNPDVQFLQVNYEEHKSMCYSLNVHVLPFF 183 >ref|XP_006829786.1| hypothetical protein AMTR_s00119p00048970 [Amborella trichopoda] gi|548835367|gb|ERM97202.1| hypothetical protein AMTR_s00119p00048970 [Amborella trichopoda] Length = 268 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 248 KAMTFCGMNPDVQFLQINYEEHKSMCYSLNVHVLPFF 358 K F NPDVQFLQ+NYEEHKSMCYSLNVHVLPFF Sbjct: 126 KICQFAETNPDVQFLQVNYEEHKSMCYSLNVHVLPFF 162 >ref|XP_006305501.1| hypothetical protein CARUB_v10009966mg [Capsella rubella] gi|482574212|gb|EOA38399.1| hypothetical protein CARUB_v10009966mg [Capsella rubella] Length = 279 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 248 KAMTFCGMNPDVQFLQINYEEHKSMCYSLNVHVLPFF 358 K F MNPDVQFLQ+NYEEHKSMCYSL VHVLPFF Sbjct: 142 KICQFAEMNPDVQFLQVNYEEHKSMCYSLGVHVLPFF 178 >ref|XP_007202385.1| hypothetical protein PRUPE_ppa009372mg [Prunus persica] gi|462397916|gb|EMJ03584.1| hypothetical protein PRUPE_ppa009372mg [Prunus persica] Length = 295 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 269 MNPDVQFLQINYEEHKSMCYSLNVHVLPFF 358 MNPDVQFLQ+NYEEHKSMCYSLNVHVLPFF Sbjct: 157 MNPDVQFLQVNYEEHKSMCYSLNVHVLPFF 186 >ref|XP_007202384.1| hypothetical protein PRUPE_ppa009372mg [Prunus persica] gi|462397915|gb|EMJ03583.1| hypothetical protein PRUPE_ppa009372mg [Prunus persica] Length = 294 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 269 MNPDVQFLQINYEEHKSMCYSLNVHVLPFF 358 MNPDVQFLQ+NYEEHKSMCYSLNVHVLPFF Sbjct: 156 MNPDVQFLQVNYEEHKSMCYSLNVHVLPFF 185 >ref|XP_004252003.1| PREDICTED: thioredoxin-like 1-1, chloroplastic-like [Solanum lycopersicum] Length = 299 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 269 MNPDVQFLQINYEEHKSMCYSLNVHVLPFF 358 MNPDVQFLQ+NYEEHKSMCYSLNVHVLPFF Sbjct: 150 MNPDVQFLQVNYEEHKSMCYSLNVHVLPFF 179 >ref|NP_172333.1| atypical CYS HIS rich thioredoxin 4 [Arabidopsis thaliana] gi|51701910|sp|O64654.1|TRL11_ARATH RecName: Full=Thioredoxin-like 1-1, chloroplastic; AltName: Full=Atypical cysteine/histidine-rich thioredoxin 4; Short=AtACHT4; AltName: Full=Lilium-type thioredoxin 1-1; Flags: Precursor gi|4973256|gb|AAD35005.1|AF144387_1 thioredoxin-like 1 [Arabidopsis thaliana] gi|9802552|gb|AAF99754.1|AC003981_4 F22O13.5 [Arabidopsis thaliana] gi|14334494|gb|AAK59444.1| putative thioredoxin [Arabidopsis thaliana] gi|17104801|gb|AAL34289.1| putative thioredoxin [Arabidopsis thaliana] gi|332190186|gb|AEE28307.1| atypical CYS HIS rich thioredoxin 4 [Arabidopsis thaliana] Length = 275 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 248 KAMTFCGMNPDVQFLQINYEEHKSMCYSLNVHVLPFF 358 K F MNPDVQFLQ+NYEEHKSMCYSL VHVLPFF Sbjct: 138 KICQFAEMNPDVQFLQVNYEEHKSMCYSLGVHVLPFF 174 >gb|AFH68082.1| thioredoxin-like protein 1.2, partial [Populus trichocarpa x Populus deltoides] Length = 222 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 269 MNPDVQFLQINYEEHKSMCYSLNVHVLPFF 358 MNPDVQFLQ+NYEEHKSMCYSLNVHVLPFF Sbjct: 72 MNPDVQFLQVNYEEHKSMCYSLNVHVLPFF 101