BLASTX nr result
ID: Paeonia24_contig00008923
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00008923 (598 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004252213.1| PREDICTED: zinc finger CCCH domain-containin... 50 9e-06 >ref|XP_004252213.1| PREDICTED: zinc finger CCCH domain-containing protein 41-like [Solanum lycopersicum] Length = 877 Score = 50.4 bits (119), Expect(2) = 9e-06 Identities = 20/33 (60%), Positives = 26/33 (78%) Frame = +1 Query: 499 NTFHSLGLQGTLEPQINPSLNIVIPRQRCEGFE 597 +T HS+G QGTL P +NP++N+ IPRQRC FE Sbjct: 187 DTLHSVGFQGTLRPSLNPTMNMGIPRQRCRDFE 219 Score = 25.0 bits (53), Expect(2) = 9e-06 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +3 Query: 411 KGLQNIFSAQSASWS 455 +G++NI +AQS+SWS Sbjct: 159 RGVENIANAQSSSWS 173