BLASTX nr result
ID: Paeonia24_contig00008553
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00008553 (253 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007204808.1| hypothetical protein PRUPE_ppa025649mg [Prun... 57 3e-06 ref|XP_002534408.1| small nuclear ribonucleoprotein f, putative ... 55 8e-06 >ref|XP_007204808.1| hypothetical protein PRUPE_ppa025649mg [Prunus persica] gi|462400339|gb|EMJ06007.1| hypothetical protein PRUPE_ppa025649mg [Prunus persica] Length = 135 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 153 EEMSGGAEKGAMTAKTPAEFLKSIRGRPVVVKL 251 E+MSGG EKG T KTPA+FLKSIRGRPVVVKL Sbjct: 43 EKMSGGGEKGTGTTKTPADFLKSIRGRPVVVKL 75 >ref|XP_002534408.1| small nuclear ribonucleoprotein f, putative [Ricinus communis] gi|223525355|gb|EEF27977.1| small nuclear ribonucleoprotein f, putative [Ricinus communis] Length = 91 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 159 MSGGAEKGAMTAKTPAEFLKSIRGRPVVVKL 251 MSGG EKG+ T KTPA+FLKSIRGRPVVVKL Sbjct: 1 MSGGGEKGSATTKTPADFLKSIRGRPVVVKL 31