BLASTX nr result
ID: Paeonia24_contig00008484
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00008484 (347 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB55019.1| hypothetical protein L484_007350 [Morus notabilis] 59 5e-07 >gb|EXB55019.1| hypothetical protein L484_007350 [Morus notabilis] Length = 371 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -3 Query: 345 ASLAFEHKKRSTLTTDIIEYLGTSLEDICPV 253 ASLAFE KKRSTLTTDIIEYLG SLEDICPV Sbjct: 340 ASLAFEDKKRSTLTTDIIEYLGRSLEDICPV 370