BLASTX nr result
ID: Paeonia24_contig00008384
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00008384 (216 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006421436.1| hypothetical protein CICLE_v10004423mg [Citr... 70 2e-10 ref|XP_002277747.2| PREDICTED: zinc finger CCCH domain-containin... 69 9e-10 ref|XP_002308038.2| zinc finger family protein [Populus trichoca... 68 1e-09 ref|XP_006493920.1| PREDICTED: zinc finger CCCH domain-containin... 67 3e-09 gb|ADL36655.1| C3HL domain class transcription factor [Malus dom... 64 3e-08 ref|XP_002526717.1| nucleic acid binding protein, putative [Rici... 64 3e-08 ref|XP_006345451.1| PREDICTED: zinc finger CCCH domain-containin... 63 5e-08 ref|XP_007028819.1| C3HL domain class transcription factor isofo... 61 1e-07 ref|XP_007204626.1| hypothetical protein PRUPE_ppa002189mg [Prun... 61 1e-07 ref|XP_002323312.1| zinc finger family protein [Populus trichoca... 61 1e-07 ref|XP_007145619.1| hypothetical protein PHAVU_007G254100g [Phas... 60 2e-07 ref|XP_004493518.1| PREDICTED: zinc finger CCCH domain-containin... 60 2e-07 gb|ADL36658.1| C3HL domain class transcription factor [Malus dom... 60 3e-07 ref|XP_006589016.1| PREDICTED: zinc finger CCCH domain-containin... 60 4e-07 ref|XP_002308039.2| zinc finger family protein [Populus trichoca... 59 7e-07 gb|EXB32787.1| Zinc finger CCCH domain-containing protein 30 [Mo... 58 2e-06 ref|XP_002526718.1| nucleic acid binding protein, putative [Rici... 58 2e-06 ref|XP_004229627.1| PREDICTED: zinc finger CCCH domain-containin... 57 2e-06 ref|XP_006351322.1| PREDICTED: zinc finger CCCH domain-containin... 57 3e-06 ref|XP_004249271.1| PREDICTED: zinc finger CCCH domain-containin... 57 3e-06 >ref|XP_006421436.1| hypothetical protein CICLE_v10004423mg [Citrus clementina] gi|557523309|gb|ESR34676.1| hypothetical protein CICLE_v10004423mg [Citrus clementina] Length = 731 Score = 70.5 bits (171), Expect = 2e-10 Identities = 42/71 (59%), Positives = 45/71 (63%) Frame = +3 Query: 3 PNLADANGHRPVDVIVVSPKFQDVKLTLEELLATNGDSVGGCNLRVSIATXXXXXXXXXX 182 PNL DA GHRPVDVIVV PKFQDV+LTLEELLAT+G NLRVS T Sbjct: 152 PNLVDAKGHRPVDVIVVPPKFQDVRLTLEELLATDGSVER--NLRVSTTT---SNSNSPP 206 Query: 183 XXXXXENGSPS 215 ENGSP+ Sbjct: 207 LSPALENGSPT 217 >ref|XP_002277747.2| PREDICTED: zinc finger CCCH domain-containing protein 30-like [Vitis vinifera] Length = 703 Score = 68.6 bits (166), Expect = 9e-10 Identities = 36/50 (72%), Positives = 38/50 (76%) Frame = +3 Query: 3 PNLADANGHRPVDVIVVSPKFQDVKLTLEELLATNGDSVGGCNLRVSIAT 152 PN DANGHRPVDV+VV PK QDVK TLEELLATNG SV NL +S T Sbjct: 122 PNSLDANGHRPVDVLVVPPKLQDVKATLEELLATNGSSVER-NLSISTVT 170 >ref|XP_002308038.2| zinc finger family protein [Populus trichocarpa] gi|550335507|gb|EEE91561.2| zinc finger family protein [Populus trichocarpa] Length = 735 Score = 67.8 bits (164), Expect = 1e-09 Identities = 40/69 (57%), Positives = 45/69 (65%) Frame = +3 Query: 6 NLADANGHRPVDVIVVSPKFQDVKLTLEELLATNGDSVGGCNLRVSIATXXXXXXXXXXX 185 NLADANGHRP+DVIVV PK QDV+L L++LLA +G V NLRVSIAT Sbjct: 153 NLADANGHRPIDVIVVPPKLQDVRLVLKDLLAADGSHVEQ-NLRVSIAT---ENSNSPPL 208 Query: 186 XXXXENGSP 212 ENGSP Sbjct: 209 SPSMENGSP 217 >ref|XP_006493920.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like isoform X1 [Citrus sinensis] gi|568882188|ref|XP_006493921.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like isoform X2 [Citrus sinensis] Length = 732 Score = 67.0 bits (162), Expect = 3e-09 Identities = 40/71 (56%), Positives = 43/71 (60%) Frame = +3 Query: 3 PNLADANGHRPVDVIVVSPKFQDVKLTLEELLATNGDSVGGCNLRVSIATXXXXXXXXXX 182 PN DA GH PVDVIVV PKFQDV+LTLEELLAT+G NLRVS T Sbjct: 152 PNFVDAKGHHPVDVIVVPPKFQDVRLTLEELLATDGSVER--NLRVSTTT---SNSNSPP 206 Query: 183 XXXXXENGSPS 215 ENGSP+ Sbjct: 207 LSPALENGSPT 217 >gb|ADL36655.1| C3HL domain class transcription factor [Malus domestica] Length = 736 Score = 63.5 bits (153), Expect = 3e-08 Identities = 38/71 (53%), Positives = 42/71 (59%) Frame = +3 Query: 3 PNLADANGHRPVDVIVVSPKFQDVKLTLEELLATNGDSVGGCNLRVSIATXXXXXXXXXX 182 PNL DANGHRP+DVIVV P+ Q+VKL LEELL NG + G L VS T Sbjct: 152 PNLLDANGHRPIDVIVVPPRLQNVKLALEELLVING-TAGEKTLTVSTRT---IHSTSPP 207 Query: 183 XXXXXENGSPS 215 ENGSPS Sbjct: 208 LSASPENGSPS 218 >ref|XP_002526717.1| nucleic acid binding protein, putative [Ricinus communis] gi|223533906|gb|EEF35631.1| nucleic acid binding protein, putative [Ricinus communis] Length = 725 Score = 63.5 bits (153), Expect = 3e-08 Identities = 37/70 (52%), Positives = 43/70 (61%) Frame = +3 Query: 3 PNLADANGHRPVDVIVVSPKFQDVKLTLEELLATNGDSVGGCNLRVSIATXXXXXXXXXX 182 PNL DANGHRP+DVIVV PK ++VK TLEELLA + +G NLR+S T Sbjct: 152 PNLTDANGHRPIDVIVVPPKLRNVKFTLEELLAIDRAFIGH-NLRISTRT---SDSNSPP 207 Query: 183 XXXXXENGSP 212 ENGSP Sbjct: 208 LSPSVENGSP 217 >ref|XP_006345451.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like isoform X1 [Solanum tuberosum] gi|565357238|ref|XP_006345452.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like isoform X2 [Solanum tuberosum] Length = 730 Score = 62.8 bits (151), Expect = 5e-08 Identities = 37/73 (50%), Positives = 41/73 (56%), Gaps = 2/73 (2%) Frame = +3 Query: 3 PNLADANGHRPVDVIVVSPKFQDVKLTLEELLATNGD--SVGGCNLRVSIATXXXXXXXX 176 PN+ DANG RP DVIVV PK + +LEELL N SVG C LRVS+AT Sbjct: 143 PNVEDANGQRPADVIVVPPKLPGARASLEELLLNNSSDGSVGDCKLRVSVAT---SDASS 199 Query: 177 XXXXXXXENGSPS 215 ENGSPS Sbjct: 200 PILSPSPENGSPS 212 >ref|XP_007028819.1| C3HL domain class transcription factor isoform 1 [Theobroma cacao] gi|590636299|ref|XP_007028820.1| C3HL domain class transcription factor isoform 1 [Theobroma cacao] gi|590636303|ref|XP_007028821.1| C3HL domain class transcription factor isoform 1 [Theobroma cacao] gi|508717424|gb|EOY09321.1| C3HL domain class transcription factor isoform 1 [Theobroma cacao] gi|508717425|gb|EOY09322.1| C3HL domain class transcription factor isoform 1 [Theobroma cacao] gi|508717426|gb|EOY09323.1| C3HL domain class transcription factor isoform 1 [Theobroma cacao] Length = 727 Score = 61.2 bits (147), Expect = 1e-07 Identities = 39/70 (55%), Positives = 42/70 (60%) Frame = +3 Query: 6 NLADANGHRPVDVIVVSPKFQDVKLTLEELLATNGDSVGGCNLRVSIATXXXXXXXXXXX 185 N+ DANGH PVDV+VV PK Q +KLTLEELLAT SV NLRVS A Sbjct: 153 NMVDANGHLPVDVVVVPPKLQALKLTLEELLATE-SSVLERNLRVSTAV---ANSSSPPL 208 Query: 186 XXXXENGSPS 215 ENGSPS Sbjct: 209 SPSQENGSPS 218 >ref|XP_007204626.1| hypothetical protein PRUPE_ppa002189mg [Prunus persica] gi|462400157|gb|EMJ05825.1| hypothetical protein PRUPE_ppa002189mg [Prunus persica] Length = 703 Score = 61.2 bits (147), Expect = 1e-07 Identities = 38/71 (53%), Positives = 42/71 (59%) Frame = +3 Query: 3 PNLADANGHRPVDVIVVSPKFQDVKLTLEELLATNGDSVGGCNLRVSIATXXXXXXXXXX 182 PNL DANGHRPV+VIVV P+ Q+V+L LEELL NG S G L VS T Sbjct: 123 PNLVDANGHRPVEVIVVPPRLQNVRLALEELLMING-SAGEQILTVSTRT---LHSSSPP 178 Query: 183 XXXXXENGSPS 215 ENGSPS Sbjct: 179 LSASPENGSPS 189 >ref|XP_002323312.1| zinc finger family protein [Populus trichocarpa] gi|222867942|gb|EEF05073.1| zinc finger family protein [Populus trichocarpa] Length = 732 Score = 61.2 bits (147), Expect = 1e-07 Identities = 38/70 (54%), Positives = 41/70 (58%), Gaps = 1/70 (1%) Frame = +3 Query: 6 NLADANGHRPVDVIVVSPKFQDVKLTLEELLATNGDSV-GGCNLRVSIATXXXXXXXXXX 182 NL DANGHRP+DVI V PK QD +L LEE LA +G V NLRVSIAT Sbjct: 153 NLVDANGHRPIDVINVPPKLQDARLILEEFLAADGSLVEHEHNLRVSIAT---MNSNSPP 209 Query: 183 XXXXXENGSP 212 ENGSP Sbjct: 210 LSPSRENGSP 219 >ref|XP_007145619.1| hypothetical protein PHAVU_007G254100g [Phaseolus vulgaris] gi|561018809|gb|ESW17613.1| hypothetical protein PHAVU_007G254100g [Phaseolus vulgaris] Length = 700 Score = 60.5 bits (145), Expect = 2e-07 Identities = 36/71 (50%), Positives = 41/71 (57%) Frame = +3 Query: 3 PNLADANGHRPVDVIVVSPKFQDVKLTLEELLATNGDSVGGCNLRVSIATXXXXXXXXXX 182 PN D NGHRPVDVIV PK + V+ +LE LL T+ DS+G CNLRV A Sbjct: 123 PNSVDGNGHRPVDVIVFPPKHESVRNSLEALLQTD-DSIGVCNLRVITA---PSNAYSPP 178 Query: 183 XXXXXENGSPS 215 ENGSPS Sbjct: 179 LSTSPENGSPS 189 >ref|XP_004493518.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like [Cicer arietinum] Length = 727 Score = 60.5 bits (145), Expect = 2e-07 Identities = 36/71 (50%), Positives = 41/71 (57%) Frame = +3 Query: 3 PNLADANGHRPVDVIVVSPKFQDVKLTLEELLATNGDSVGGCNLRVSIATXXXXXXXXXX 182 PN DANGHRP+DVIV PK + VK +LEELL T+ D GCNLRV + Sbjct: 152 PNAVDANGHRPLDVIVFPPKLEFVKNSLEELLQTD-DPSAGCNLRVITTS---FNTYSPP 207 Query: 183 XXXXXENGSPS 215 ENGSPS Sbjct: 208 LSASPENGSPS 218 >gb|ADL36658.1| C3HL domain class transcription factor [Malus domestica] gi|302398729|gb|ADL36659.1| C3HL domain class transcription factor [Malus domestica] Length = 731 Score = 60.1 bits (144), Expect = 3e-07 Identities = 38/71 (53%), Positives = 40/71 (56%) Frame = +3 Query: 3 PNLADANGHRPVDVIVVSPKFQDVKLTLEELLATNGDSVGGCNLRVSIATXXXXXXXXXX 182 PN DANGH P DVIVV P+ Q+VKL LEELL NG SVG L VS T Sbjct: 152 PNSVDANGHHPNDVIVVPPRLQNVKLALEELLMVNG-SVGEQTLTVSTRT---VHSSSPP 207 Query: 183 XXXXXENGSPS 215 ENGSPS Sbjct: 208 LSASPENGSPS 218 >ref|XP_006589016.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like [Glycine max] Length = 710 Score = 59.7 bits (143), Expect = 4e-07 Identities = 36/71 (50%), Positives = 40/71 (56%) Frame = +3 Query: 3 PNLADANGHRPVDVIVVSPKFQDVKLTLEELLATNGDSVGGCNLRVSIATXXXXXXXXXX 182 PN D NGHRPVDVIVV PK + V+ LE LL T+ DS+ CNLRV A Sbjct: 123 PNSVDGNGHRPVDVIVVPPKHESVRNNLEALLQTD-DSIAVCNLRVITA---PSNAYSPP 178 Query: 183 XXXXXENGSPS 215 ENGSPS Sbjct: 179 LSTSSENGSPS 189 >ref|XP_002308039.2| zinc finger family protein [Populus trichocarpa] gi|550335508|gb|EEE91562.2| zinc finger family protein [Populus trichocarpa] Length = 701 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/48 (60%), Positives = 37/48 (77%) Frame = +3 Query: 6 NLADANGHRPVDVIVVSPKFQDVKLTLEELLATNGDSVGGCNLRVSIA 149 N+ DANGHRP+D IVV PKFQ+ +LTLEELL+ G + NLRVS++ Sbjct: 125 NVVDANGHRPIDAIVVPPKFQEARLTLEELLSAEGYVIEH-NLRVSMS 171 >gb|EXB32787.1| Zinc finger CCCH domain-containing protein 30 [Morus notabilis] Length = 755 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 2/50 (4%) Frame = +3 Query: 3 PNLADANGHRPVDVIVVSPKFQDVKLTLEELLATNGD--SVGGCNLRVSI 146 PNL DANGH PVDV+VV PK Q++++TLEELL+ + SVG +LR+SI Sbjct: 147 PNLMDANGHCPVDVLVVHPKLQNMRVTLEELLSKDASDGSVGEQSLRLSI 196 >ref|XP_002526718.1| nucleic acid binding protein, putative [Ricinus communis] gi|223533907|gb|EEF35632.1| nucleic acid binding protein, putative [Ricinus communis] Length = 728 Score = 57.8 bits (138), Expect = 2e-06 Identities = 32/50 (64%), Positives = 35/50 (70%) Frame = +3 Query: 3 PNLADANGHRPVDVIVVSPKFQDVKLTLEELLATNGDSVGGCNLRVSIAT 152 PN DANGHRP+DVIVV PK VK LEELL +G SV +LRVS AT Sbjct: 152 PNSIDANGHRPIDVIVVPPKLDGVKFALEELLVNDG-SVIERDLRVSTAT 200 >ref|XP_004229627.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like [Solanum lycopersicum] Length = 724 Score = 57.4 bits (137), Expect = 2e-06 Identities = 34/72 (47%), Positives = 39/72 (54%), Gaps = 2/72 (2%) Frame = +3 Query: 3 PNLADANGHRPVDVIVVSPKFQDVKLTLEELLATNGD--SVGGCNLRVSIATXXXXXXXX 176 PN+ DANG RP DVIVV PK + +LE+LL N SVG C L VS+AT Sbjct: 143 PNVEDANGQRPADVIVVPPKLPGTRASLEKLLLNNSSDGSVGDCKLTVSVAT---SDASS 199 Query: 177 XXXXXXXENGSP 212 ENGSP Sbjct: 200 PILSSSPENGSP 211 >ref|XP_006351322.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like [Solanum tuberosum] Length = 697 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/50 (56%), Positives = 35/50 (70%) Frame = +3 Query: 3 PNLADANGHRPVDVIVVSPKFQDVKLTLEELLATNGDSVGGCNLRVSIAT 152 P+ D NGH P+DVIVVSP F VK LE LL T+ ++G C LRVS++T Sbjct: 124 PHSKDINGHYPIDVIVVSPSFHPVKSCLESLLMTS--TIGDCKLRVSVST 171 >ref|XP_004249271.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like [Solanum lycopersicum] Length = 697 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/50 (56%), Positives = 35/50 (70%) Frame = +3 Query: 3 PNLADANGHRPVDVIVVSPKFQDVKLTLEELLATNGDSVGGCNLRVSIAT 152 P+ D NGH P+DVIVVSP F VK LE LL T+ ++G C LRVS++T Sbjct: 124 PHSKDINGHYPIDVIVVSPNFHPVKSCLESLLMTS--TIGDCKLRVSVST 171