BLASTX nr result
ID: Paeonia24_contig00008142
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00008142 (1253 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006419564.1| hypothetical protein CICLE_v10006971mg [Citr... 61 1e-06 gb|EYU40743.1| hypothetical protein MIMGU_mgv1a021749mg [Mimulus... 60 2e-06 gb|EYU28209.1| hypothetical protein MIMGU_mgv1a023317mg [Mimulus... 60 2e-06 ref|XP_002312730.1| F-box family protein [Populus trichocarpa] g... 58 3e-06 ref|XP_007217801.1| hypothetical protein PRUPE_ppa025351mg, part... 59 3e-06 ref|XP_007202903.1| hypothetical protein PRUPE_ppa016094mg, part... 59 4e-06 >ref|XP_006419564.1| hypothetical protein CICLE_v10006971mg [Citrus clementina] gi|557521437|gb|ESR32804.1| hypothetical protein CICLE_v10006971mg [Citrus clementina] Length = 159 Score = 60.8 bits (146), Expect = 1e-06 Identities = 29/75 (38%), Positives = 45/75 (60%), Gaps = 1/75 (1%) Frame = -2 Query: 223 FINEPSHDELEFPLKDPQRRGDRVVGSCNGLLCIQIER-PQVILWNPSTRQFNILPKLDR 47 F ++ + L+FP + P V+GSC+GL+CI + ++++NPST + LP LD Sbjct: 44 FDDQNASTPLDFPFRKPYSTNAHVIGSCHGLVCIAFDNCEDIVIYNPSTGDYRKLPNLDI 103 Query: 46 AFDDLRYRVLYGFGY 2 + D RY+ YGFGY Sbjct: 104 SSGDTRYQ--YGFGY 116 >gb|EYU40743.1| hypothetical protein MIMGU_mgv1a021749mg [Mimulus guttatus] Length = 394 Score = 60.5 bits (145), Expect = 2e-06 Identities = 29/66 (43%), Positives = 42/66 (63%) Frame = -2 Query: 199 ELEFPLKDPQRRGDRVVGSCNGLLCIQIERPQVILWNPSTRQFNILPKLDRAFDDLRYRV 20 +++FP+++P RVVGSCNGL+C + + LWNPSTR+F LP D D ++ Sbjct: 113 DVDFPIRNPND-SVRVVGSCNGLICTILNEKLIYLWNPSTRKFKKLPNAD---DRIKVIS 168 Query: 19 LYGFGY 2 YGFG+ Sbjct: 169 KYGFGF 174 >gb|EYU28209.1| hypothetical protein MIMGU_mgv1a023317mg [Mimulus guttatus] Length = 363 Score = 60.5 bits (145), Expect = 2e-06 Identities = 29/66 (43%), Positives = 42/66 (63%) Frame = -2 Query: 199 ELEFPLKDPQRRGDRVVGSCNGLLCIQIERPQVILWNPSTRQFNILPKLDRAFDDLRYRV 20 +++FP+++P RVVGSCNGL+C + + LWNPSTR+F LP D D ++ Sbjct: 82 DVDFPIRNPND-SVRVVGSCNGLICTILNEKLIYLWNPSTRKFKKLPNAD---DRIKVIS 137 Query: 19 LYGFGY 2 YGFG+ Sbjct: 138 KYGFGF 143 >ref|XP_002312730.1| F-box family protein [Populus trichocarpa] gi|222852550|gb|EEE90097.1| F-box family protein [Populus trichocarpa] Length = 445 Score = 57.8 bits (138), Expect(2) = 3e-06 Identities = 30/55 (54%), Positives = 38/55 (69%) Frame = -2 Query: 166 RGDRVVGSCNGLLCIQIERPQVILWNPSTRQFNILPKLDRAFDDLRYRVLYGFGY 2 R D VVGSC+GL+C+ I++ V+LWNPSTR FN LP L A L ++GFGY Sbjct: 177 RYDWVVGSCDGLVCLGIKQDFVVLWNPSTRVFNRLPDLGFA-KKLGSYTVFGFGY 230 Score = 21.6 bits (44), Expect(2) = 3e-06 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -1 Query: 275 ITTVDPNFSFRYCSLNSIY 219 I++ +P F + CSL S+Y Sbjct: 139 ISSSEPLFRLKSCSLYSVY 157 >ref|XP_007217801.1| hypothetical protein PRUPE_ppa025351mg, partial [Prunus persica] gi|462413951|gb|EMJ19000.1| hypothetical protein PRUPE_ppa025351mg, partial [Prunus persica] Length = 391 Score = 59.3 bits (142), Expect = 3e-06 Identities = 26/66 (39%), Positives = 38/66 (57%) Frame = -2 Query: 199 ELEFPLKDPQRRGDRVVGSCNGLLCIQIERPQVILWNPSTRQFNILPKLDRAFDDLRYRV 20 EL+ P+K P R+VGSCNGL+C+Q+ +++WNP T +LPK + Sbjct: 102 ELDLPVKIPDILITRIVGSCNGLICLQVNYTNIVIWNPCTGHSKLLPKPSSLLSGF---L 158 Query: 19 LYGFGY 2 +GFGY Sbjct: 159 FFGFGY 164 >ref|XP_007202903.1| hypothetical protein PRUPE_ppa016094mg, partial [Prunus persica] gi|462398434|gb|EMJ04102.1| hypothetical protein PRUPE_ppa016094mg, partial [Prunus persica] Length = 341 Score = 58.9 bits (141), Expect = 4e-06 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 1/66 (1%) Frame = -2 Query: 196 LEFPLKDPQRRGDRVVGSCNGLLCIQIERPQVI-LWNPSTRQFNILPKLDRAFDDLRYRV 20 L FPLK Q R +V+GSCNGL+C+ ++ + +WNPSTR LP D +++R Sbjct: 94 LSFPLKQ-QGRAVKVLGSCNGLVCVALDFHECFYIWNPSTRFLQKLPDPDFGSEEIRRHY 152 Query: 19 LYGFGY 2 YGFGY Sbjct: 153 KYGFGY 158