BLASTX nr result
ID: Paeonia24_contig00008124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00008124 (436 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67358.1| hypothetical protein VITISV_032924 [Vitis vinifera] 58 1e-06 emb|CAN75533.1| hypothetical protein VITISV_024796 [Vitis vinifera] 57 2e-06 >emb|CAN67358.1| hypothetical protein VITISV_032924 [Vitis vinifera] Length = 590 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 117 ISCESNYDIWSQLMEMQIAERNKISYIRGKTKPP 16 I ESNYD+WSQL+E+ IAER K+SYIRGKT PP Sbjct: 49 ILTESNYDVWSQLVELHIAEREKLSYIRGKTNPP 82 >emb|CAN75533.1| hypothetical protein VITISV_024796 [Vitis vinifera] Length = 861 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -2 Query: 117 ISCESNYDIWSQLMEMQIAERNKISYIRGKTKPP 16 I ESNYDIWSQLMEM IAER K+SYIRGKT P Sbjct: 22 ILTESNYDIWSQLMEMHIAEREKLSYIRGKTNLP 55