BLASTX nr result
ID: Paeonia24_contig00007576
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00007576 (871 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006355420.1| PREDICTED: peroxisomal acyl-coenzyme A oxida... 80 1e-12 gb|AAW78691.1| peroxisomal acyl-CoA oxidase 1A [Solanum cheesman... 80 1e-12 ref|NP_001234198.1| peroxisomal acyl-CoA oxidase 1A [Solanum lyc... 80 1e-12 pdb|2FON|A Chain A, X-Ray Crystal Structure Of Leacx1, An Acyl-C... 80 1e-12 ref|XP_006837312.1| hypothetical protein AMTR_s00111p00062720 [A... 79 2e-12 gb|EPS60529.1| hypothetical protein M569_14274, partial [Genlise... 79 3e-12 ref|XP_002303363.2| acyl-CoA oxidase family protein [Populus tri... 78 4e-12 ref|XP_003608684.1| Peroxisomal acyl-CoA oxidase 1A [Medicago tr... 78 4e-12 ref|XP_006355419.1| PREDICTED: peroxisomal acyl-coenzyme A oxida... 77 7e-12 ref|XP_006355418.1| PREDICTED: peroxisomal acyl-coenzyme A oxida... 77 7e-12 ref|XP_006440266.1| hypothetical protein CICLE_v10019196mg [Citr... 77 7e-12 ref|XP_006440265.1| hypothetical protein CICLE_v10019196mg [Citr... 77 7e-12 ref|XP_006440264.1| hypothetical protein CICLE_v10019196mg [Citr... 77 7e-12 ref|XP_003517411.2| PREDICTED: peroxisomal acyl-coenzyme A oxida... 77 9e-12 ref|XP_006368995.1| acyl-CoA oxidase family protein [Populus tri... 77 1e-11 ref|XP_007210302.1| hypothetical protein PRUPE_ppa002510mg [Prun... 75 1e-11 ref|XP_007155689.1| hypothetical protein PHAVU_003G222800g [Phas... 76 1e-11 ref|XP_007039778.1| Acyl-CoA oxidase 1 [Theobroma cacao] gi|5087... 76 1e-11 ref|XP_003635297.1| PREDICTED: peroxisomal acyl-coenzyme A oxida... 76 1e-11 emb|CBI33074.3| unnamed protein product [Vitis vinifera] 76 1e-11 >ref|XP_006355420.1| PREDICTED: peroxisomal acyl-coenzyme A oxidase 1-like [Solanum tuberosum] Length = 664 Score = 79.7 bits (195), Expect = 1e-12 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = -1 Query: 514 PLSGITVGDIGMKFGNGAYNTMDNGVLSFDHVRIPRD*M*MR 389 PL G+TVGDIGMKFGNGAYN+MDNGVLSFDHVRIPRD M MR Sbjct: 216 PLPGVTVGDIGMKFGNGAYNSMDNGVLSFDHVRIPRDQMLMR 257 >gb|AAW78691.1| peroxisomal acyl-CoA oxidase 1A [Solanum cheesmaniae] Length = 664 Score = 79.7 bits (195), Expect = 1e-12 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = -1 Query: 514 PLSGITVGDIGMKFGNGAYNTMDNGVLSFDHVRIPRD*M*MR 389 PL G+TVGDIGMKFGNGAYN+MDNGVLSFDHVRIPRD M MR Sbjct: 216 PLPGVTVGDIGMKFGNGAYNSMDNGVLSFDHVRIPRDQMLMR 257 >ref|NP_001234198.1| peroxisomal acyl-CoA oxidase 1A [Solanum lycopersicum] gi|58531948|gb|AAW78689.1| peroxisomal acyl-CoA oxidase 1A [Solanum lycopersicum] Length = 664 Score = 79.7 bits (195), Expect = 1e-12 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = -1 Query: 514 PLSGITVGDIGMKFGNGAYNTMDNGVLSFDHVRIPRD*M*MR 389 PL G+TVGDIGMKFGNGAYN+MDNGVLSFDHVRIPRD M MR Sbjct: 216 PLPGVTVGDIGMKFGNGAYNSMDNGVLSFDHVRIPRDQMLMR 257 >pdb|2FON|A Chain A, X-Ray Crystal Structure Of Leacx1, An Acyl-Coa Oxidase From Lycopersicon Esculentum (Tomato) gi|109157677|pdb|2FON|B Chain B, X-Ray Crystal Structure Of Leacx1, An Acyl-Coa Oxidase From Lycopersicon Esculentum (Tomato) gi|109157678|pdb|2FON|C Chain C, X-Ray Crystal Structure Of Leacx1, An Acyl-Coa Oxidase From Lycopersicon Esculentum (Tomato) Length = 683 Score = 79.7 bits (195), Expect = 1e-12 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = -1 Query: 514 PLSGITVGDIGMKFGNGAYNTMDNGVLSFDHVRIPRD*M*MR 389 PL G+TVGDIGMKFGNGAYN+MDNGVLSFDHVRIPRD M MR Sbjct: 235 PLPGVTVGDIGMKFGNGAYNSMDNGVLSFDHVRIPRDQMLMR 276 >ref|XP_006837312.1| hypothetical protein AMTR_s00111p00062720 [Amborella trichopoda] gi|548839930|gb|ERN00166.1| hypothetical protein AMTR_s00111p00062720 [Amborella trichopoda] Length = 664 Score = 79.3 bits (194), Expect = 2e-12 Identities = 38/43 (88%), Positives = 39/43 (90%) Frame = -1 Query: 517 SPLSGITVGDIGMKFGNGAYNTMDNGVLSFDHVRIPRD*M*MR 389 SPL GITVGDIGMKFGNGAYNTMDNGVL FDHVRIPR+ M MR Sbjct: 215 SPLPGITVGDIGMKFGNGAYNTMDNGVLRFDHVRIPRNQMLMR 257 >gb|EPS60529.1| hypothetical protein M569_14274, partial [Genlisea aurea] Length = 387 Score = 78.6 bits (192), Expect = 3e-12 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = -1 Query: 517 SPLSGITVGDIGMKFGNGAYNTMDNGVLSFDHVRIPRD*M*MR 389 +PL GITVGDIG+KFGNGAYNTMDNGVL FDHVRIPRD M MR Sbjct: 168 TPLPGITVGDIGVKFGNGAYNTMDNGVLRFDHVRIPRDQMLMR 210 >ref|XP_002303363.2| acyl-CoA oxidase family protein [Populus trichocarpa] gi|550342653|gb|EEE78342.2| acyl-CoA oxidase family protein [Populus trichocarpa] Length = 663 Score = 78.2 bits (191), Expect = 4e-12 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -1 Query: 514 PLSGITVGDIGMKFGNGAYNTMDNGVLSFDHVRIPRD*M*MR 389 PL GIT+GDIGMKFGNGAYNTMDNGVL+FDHVRIPR+ M MR Sbjct: 216 PLPGITIGDIGMKFGNGAYNTMDNGVLTFDHVRIPRNQMLMR 257 >ref|XP_003608684.1| Peroxisomal acyl-CoA oxidase 1A [Medicago truncatula] gi|355509739|gb|AES90881.1| Peroxisomal acyl-CoA oxidase 1A [Medicago truncatula] Length = 664 Score = 78.2 bits (191), Expect = 4e-12 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = -1 Query: 514 PLSGITVGDIGMKFGNGAYNTMDNGVLSFDHVRIPRD*M*MR 389 PL GITVGDIGMKFGNGAYNTMDNGVL F+HVRIPRD M MR Sbjct: 216 PLPGITVGDIGMKFGNGAYNTMDNGVLRFEHVRIPRDQMLMR 257 >ref|XP_006355419.1| PREDICTED: peroxisomal acyl-coenzyme A oxidase 1-like isoform X2 [Solanum tuberosum] Length = 651 Score = 77.4 bits (189), Expect = 7e-12 Identities = 37/42 (88%), Positives = 37/42 (88%) Frame = -1 Query: 514 PLSGITVGDIGMKFGNGAYNTMDNGVLSFDHVRIPRD*M*MR 389 PL GITVGDIG KFGNGAYNTMDNGVL FDHVRIPRD M MR Sbjct: 203 PLPGITVGDIGTKFGNGAYNTMDNGVLRFDHVRIPRDQMLMR 244 >ref|XP_006355418.1| PREDICTED: peroxisomal acyl-coenzyme A oxidase 1-like isoform X1 [Solanum tuberosum] Length = 664 Score = 77.4 bits (189), Expect = 7e-12 Identities = 37/42 (88%), Positives = 37/42 (88%) Frame = -1 Query: 514 PLSGITVGDIGMKFGNGAYNTMDNGVLSFDHVRIPRD*M*MR 389 PL GITVGDIG KFGNGAYNTMDNGVL FDHVRIPRD M MR Sbjct: 216 PLPGITVGDIGTKFGNGAYNTMDNGVLRFDHVRIPRDQMLMR 257 >ref|XP_006440266.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] gi|567895558|ref|XP_006440267.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] gi|557542528|gb|ESR53506.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] gi|557542529|gb|ESR53507.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] Length = 529 Score = 77.4 bits (189), Expect = 7e-12 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -1 Query: 517 SPLSGITVGDIGMKFGNGAYNTMDNGVLSFDHVRIPRD*M*MR 389 SPL GIT+GDIGMKFGNGAYNTMDNGVL F+HVRIPR+ M MR Sbjct: 215 SPLPGITIGDIGMKFGNGAYNTMDNGVLRFEHVRIPRNQMLMR 257 >ref|XP_006440265.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] gi|557542527|gb|ESR53505.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] Length = 601 Score = 77.4 bits (189), Expect = 7e-12 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -1 Query: 517 SPLSGITVGDIGMKFGNGAYNTMDNGVLSFDHVRIPRD*M*MR 389 SPL GIT+GDIGMKFGNGAYNTMDNGVL F+HVRIPR+ M MR Sbjct: 215 SPLPGITIGDIGMKFGNGAYNTMDNGVLRFEHVRIPRNQMLMR 257 >ref|XP_006440264.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] gi|557542526|gb|ESR53504.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] Length = 664 Score = 77.4 bits (189), Expect = 7e-12 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -1 Query: 517 SPLSGITVGDIGMKFGNGAYNTMDNGVLSFDHVRIPRD*M*MR 389 SPL GIT+GDIGMKFGNGAYNTMDNGVL F+HVRIPR+ M MR Sbjct: 215 SPLPGITIGDIGMKFGNGAYNTMDNGVLRFEHVRIPRNQMLMR 257 >ref|XP_003517411.2| PREDICTED: peroxisomal acyl-coenzyme A oxidase 1-like [Glycine max] Length = 729 Score = 77.0 bits (188), Expect = 9e-12 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -1 Query: 514 PLSGITVGDIGMKFGNGAYNTMDNGVLSFDHVRIPRD*M*MR 389 PLSGIT+GDIGMKFGN AYNTMDNGVL FDHVRIPR+ M MR Sbjct: 281 PLSGITIGDIGMKFGNAAYNTMDNGVLRFDHVRIPRNQMLMR 322 >ref|XP_006368995.1| acyl-CoA oxidase family protein [Populus trichocarpa] gi|550347354|gb|ERP65564.1| acyl-CoA oxidase family protein [Populus trichocarpa] Length = 664 Score = 76.6 bits (187), Expect = 1e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -1 Query: 514 PLSGITVGDIGMKFGNGAYNTMDNGVLSFDHVRIPRD*M*MR 389 PL G+T+GDIGMKFGNGAYNTMDNGVL FDH+RIPR+ M MR Sbjct: 216 PLPGLTIGDIGMKFGNGAYNTMDNGVLKFDHIRIPRNQMLMR 257 >ref|XP_007210302.1| hypothetical protein PRUPE_ppa002510mg [Prunus persica] gi|402744131|gb|AFQ93693.1| acyl-CoA oxidase 1 [Prunus persica] gi|462406037|gb|EMJ11501.1| hypothetical protein PRUPE_ppa002510mg [Prunus persica] Length = 664 Score = 75.5 bits (184), Expect(2) = 1e-11 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -1 Query: 514 PLSGITVGDIGMKFGNGAYNTMDNGVLSFDHVRIPRD*M*MR 389 PL GITVGDIGMKFGNGAYN+MDNGVL FD+VRIPRD M MR Sbjct: 216 PLPGITVGDIGMKFGNGAYNSMDNGVLRFDNVRIPRDQMLMR 257 Score = 21.2 bits (43), Expect(2) = 1e-11 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -3 Query: 620 IRGFIVQLQNL 588 + GFIVQL+NL Sbjct: 201 VNGFIVQLRNL 211 >ref|XP_007155689.1| hypothetical protein PHAVU_003G222800g [Phaseolus vulgaris] gi|561029043|gb|ESW27683.1| hypothetical protein PHAVU_003G222800g [Phaseolus vulgaris] Length = 493 Score = 76.3 bits (186), Expect = 1e-11 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -1 Query: 514 PLSGITVGDIGMKFGNGAYNTMDNGVLSFDHVRIPRD*M*MR 389 PL GITVGDIGMKFGNGAYN+MDNGVL FDHVRIPR+ M MR Sbjct: 217 PLPGITVGDIGMKFGNGAYNSMDNGVLRFDHVRIPRNQMLMR 258 >ref|XP_007039778.1| Acyl-CoA oxidase 1 [Theobroma cacao] gi|508777023|gb|EOY24279.1| Acyl-CoA oxidase 1 [Theobroma cacao] Length = 664 Score = 76.3 bits (186), Expect = 1e-11 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -1 Query: 514 PLSGITVGDIGMKFGNGAYNTMDNGVLSFDHVRIPRD*M*MR 389 PL GITVGDIGMKFG+GAYN+MDNGVL FDHVRIPRD M MR Sbjct: 216 PLPGITVGDIGMKFGSGAYNSMDNGVLRFDHVRIPRDQMLMR 257 >ref|XP_003635297.1| PREDICTED: peroxisomal acyl-coenzyme A oxidase 1-like [Vitis vinifera] Length = 596 Score = 76.3 bits (186), Expect = 1e-11 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -1 Query: 514 PLSGITVGDIGMKFGNGAYNTMDNGVLSFDHVRIPRD*M*MR 389 PL GIT+GDIGMKFGNG YN+MDNGVL FDHVRIPRD M MR Sbjct: 148 PLPGITIGDIGMKFGNGGYNSMDNGVLRFDHVRIPRDQMLMR 189 >emb|CBI33074.3| unnamed protein product [Vitis vinifera] Length = 773 Score = 76.3 bits (186), Expect = 1e-11 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -1 Query: 514 PLSGITVGDIGMKFGNGAYNTMDNGVLSFDHVRIPRD*M*MR 389 PL GIT+GDIGMKFGNG YN+MDNGVL FDHVRIPRD M MR Sbjct: 325 PLPGITIGDIGMKFGNGGYNSMDNGVLRFDHVRIPRDQMLMR 366