BLASTX nr result
ID: Paeonia24_contig00006441
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00006441 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007043556.1| Alpha/beta-Hydrolases superfamily protein is... 60 4e-07 ref|XP_007043555.1| Alpha/beta-Hydrolases superfamily protein is... 60 4e-07 ref|XP_002267227.1| PREDICTED: epoxide hydrolase 2 [Vitis vinife... 57 2e-06 ref|XP_002267264.1| PREDICTED: epoxide hydrolase 2 [Vitis vinife... 55 8e-06 >ref|XP_007043556.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma cacao] gi|508707491|gb|EOX99387.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma cacao] Length = 264 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 316 IHFLPEGNHFVQEQLPQKVNQLIITFLNKHTTG 218 I F+PEGNHFVQEQLP++VN+LIITFLNKH G Sbjct: 232 ITFMPEGNHFVQEQLPEQVNELIITFLNKHFVG 264 >ref|XP_007043555.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma cacao] gi|508707490|gb|EOX99386.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma cacao] Length = 326 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 316 IHFLPEGNHFVQEQLPQKVNQLIITFLNKHTTG 218 I F+PEGNHFVQEQLP++VN+LIITFLNKH G Sbjct: 294 ITFMPEGNHFVQEQLPEQVNELIITFLNKHFVG 326 >ref|XP_002267227.1| PREDICTED: epoxide hydrolase 2 [Vitis vinifera] gi|297739118|emb|CBI28769.3| unnamed protein product [Vitis vinifera] Length = 313 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 316 IHFLPEGNHFVQEQLPQKVNQLIITFLNKHTT 221 I F+ EGNHFVQEQLP++VNQL+ITFLNKH+T Sbjct: 282 IIFMAEGNHFVQEQLPEQVNQLLITFLNKHST 313 >ref|XP_002267264.1| PREDICTED: epoxide hydrolase 2 [Vitis vinifera] gi|297739119|emb|CBI28770.3| unnamed protein product [Vitis vinifera] Length = 313 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 316 IHFLPEGNHFVQEQLPQKVNQLIITFLNKHTT 221 I F EGNHFVQEQLP++VNQL+ITFLNKH+T Sbjct: 282 IIFHEEGNHFVQEQLPEEVNQLLITFLNKHST 313