BLASTX nr result
ID: Paeonia24_contig00003669
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00003669 (348 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN70109.1| hypothetical protein VITISV_001696 [Vitis vinifera] 41 2e-06 >emb|CAN70109.1| hypothetical protein VITISV_001696 [Vitis vinifera] Length = 920 Score = 41.2 bits (95), Expect(2) = 2e-06 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 15/70 (21%) Frame = +1 Query: 16 SLITPNELQEALANSE*KASW------LRKWKFYESI-LPKRKK--------ILKHKEDD 150 +++ PN +Q+ALA+ KA+ L+K + +E + P RKK I+K+K DD Sbjct: 451 TVVIPNSMQKALADPRWKATMNEEMKSLQKNETWELVECPPRKKPVGCRWIYIVKYKADD 510 Query: 151 SVERFKIRLV 180 S+ERFK RLV Sbjct: 511 SIERFKARLV 520 Score = 35.8 bits (81), Expect(2) = 2e-06 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = +2 Query: 203 IRVLLPLAANLECSLQQFDVKKS 271 +RVLL LAANL+ SLQQFDVK + Sbjct: 545 VRVLLSLAANLDWSLQQFDVKNA 567