BLASTX nr result
ID: Paeonia24_contig00000233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00000233 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB67253.1| Pyrophosphate-energized vacuolar membrane proton ... 86 4e-15 gb|EXB66631.1| Pyrophosphate-energized vacuolar membrane proton ... 86 4e-15 ref|XP_006492091.1| PREDICTED: pyrophosphate-energized vacuolar ... 86 4e-15 ref|XP_007155080.1| hypothetical protein PHAVU_003G171500g [Phas... 86 4e-15 ref|XP_006427443.1| hypothetical protein CICLE_v10024946mg [Citr... 86 4e-15 ref|XP_006427441.1| hypothetical protein CICLE_v10024946mg [Citr... 86 4e-15 ref|XP_007013600.1| Inorganic H pyrophosphatase family protein i... 86 4e-15 ref|XP_004303283.1| PREDICTED: pyrophosphate-energized vacuolar ... 86 4e-15 ref|XP_007217159.1| hypothetical protein PRUPE_ppa001776mg [Prun... 86 4e-15 emb|CAA58701.1| inorganic pyrophosphatase [Nicotiana tabacum] 86 4e-15 dbj|BAA23649.1| proton pyrophosphatase [Vigna radiata] 86 4e-15 gb|AAC49175.1| pyrophosphatase [Vigna radiata] 86 4e-15 dbj|BAC41250.1| vacuolar proton-inorganic pyrophosphatase [Pyrus... 86 4e-15 gb|AEI17666.1| vacuolar H+-pyrophosphatase [Salicornia europaea] 86 4e-15 gb|AEI17665.1| vacuolar H+-pyrophosphatase [Salicornia europaea] 86 4e-15 sp|P21616.4|AVP_VIGRR RecName: Full=Pyrophosphate-energized vacu... 86 4e-15 ref|XP_003632833.1| PREDICTED: pyrophosphate-energized vacuolar ... 86 4e-15 ref|XP_003531725.1| PREDICTED: pyrophosphate-energized vacuolar ... 86 4e-15 ref|XP_003528302.1| PREDICTED: pyrophosphate-energized vacuolar ... 86 4e-15 gb|ADQ00196.1| vacuolar H+-PPase protein [Suaeda corniculata] 86 4e-15 >gb|EXB67253.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus notabilis] Length = 765 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 3 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 128 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 724 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 765 >gb|EXB66631.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus notabilis] Length = 764 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 3 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 128 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 723 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 764 >ref|XP_006492091.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1 [Citrus sinensis] Length = 766 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 3 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 128 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 725 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 766 >ref|XP_007155080.1| hypothetical protein PHAVU_003G171500g [Phaseolus vulgaris] gi|561028434|gb|ESW27074.1| hypothetical protein PHAVU_003G171500g [Phaseolus vulgaris] Length = 766 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 3 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 128 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 725 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 766 >ref|XP_006427443.1| hypothetical protein CICLE_v10024946mg [Citrus clementina] gi|557529433|gb|ESR40683.1| hypothetical protein CICLE_v10024946mg [Citrus clementina] Length = 746 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 3 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 128 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 705 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 746 >ref|XP_006427441.1| hypothetical protein CICLE_v10024946mg [Citrus clementina] gi|557529431|gb|ESR40681.1| hypothetical protein CICLE_v10024946mg [Citrus clementina] Length = 766 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 3 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 128 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 725 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 766 >ref|XP_007013600.1| Inorganic H pyrophosphatase family protein isoform 1 [Theobroma cacao] gi|508783963|gb|EOY31219.1| Inorganic H pyrophosphatase family protein isoform 1 [Theobroma cacao] Length = 770 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 3 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 128 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 729 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 770 >ref|XP_004303283.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1-like [Fragaria vesca subsp. vesca] Length = 767 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 3 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 128 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 726 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 767 >ref|XP_007217159.1| hypothetical protein PRUPE_ppa001776mg [Prunus persica] gi|462413309|gb|EMJ18358.1| hypothetical protein PRUPE_ppa001776mg [Prunus persica] Length = 767 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 3 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 128 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 726 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 767 >emb|CAA58701.1| inorganic pyrophosphatase [Nicotiana tabacum] Length = 765 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 3 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 128 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 724 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 765 >dbj|BAA23649.1| proton pyrophosphatase [Vigna radiata] Length = 766 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 3 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 128 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 725 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 766 >gb|AAC49175.1| pyrophosphatase [Vigna radiata] Length = 765 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 3 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 128 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 724 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 765 >dbj|BAC41250.1| vacuolar proton-inorganic pyrophosphatase [Pyrus communis] Length = 767 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 3 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 128 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 726 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 767 >gb|AEI17666.1| vacuolar H+-pyrophosphatase [Salicornia europaea] Length = 763 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 3 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 128 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 721 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 762 >gb|AEI17665.1| vacuolar H+-pyrophosphatase [Salicornia europaea] Length = 764 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 3 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 128 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 723 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 764 >sp|P21616.4|AVP_VIGRR RecName: Full=Pyrophosphate-energized vacuolar membrane proton pump; AltName: Full=Pyrophosphate-energized inorganic pyrophosphatase; Short=H(+)-PPase; AltName: Full=Vacuolar H(+)-pyrophosphatase gi|381353077|pdb|4A01|A Chain A, Crystal Structure Of The H-Translocating Pyrophosphatase gi|381353078|pdb|4A01|B Chain B, Crystal Structure Of The H-Translocating Pyrophosphatase Length = 766 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 3 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 128 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 725 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 766 >ref|XP_003632833.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1-like [Vitis vinifera] Length = 418 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 3 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 128 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 377 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 418 >ref|XP_003531725.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Glycine max] Length = 768 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 3 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 128 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 727 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 768 >ref|XP_003528302.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Glycine max] Length = 768 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 3 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 128 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 727 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 768 >gb|ADQ00196.1| vacuolar H+-PPase protein [Suaeda corniculata] Length = 764 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 3 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 128 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 723 IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 764