BLASTX nr result
ID: Paeonia23_contig00045604
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00045604 (284 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301410.2| hypothetical protein POPTR_0002s17230g [Popu... 56 6e-06 >ref|XP_002301410.2| hypothetical protein POPTR_0002s17230g [Populus trichocarpa] gi|550345204|gb|EEE80683.2| hypothetical protein POPTR_0002s17230g [Populus trichocarpa] Length = 291 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/101 (31%), Positives = 53/101 (52%), Gaps = 11/101 (10%) Frame = +3 Query: 12 KYFNTKHISVYKFSHFRKLKNSSTSLTYETPSNTE--THKSKCNDSFPLNPLRYSVL--- 176 K + + H S +K +H K KNS +Y+ PSN + ++K N + NPLR ++ Sbjct: 24 KLWCSGHFSFFKSTHLTKFKNSPICFSYKNPSNHQNPNPRNKNNRTLLSNPLRALIMEHI 83 Query: 177 ------TIQKWVSCFKAYNHSDSQKAIDEYNDNYLRNGGFG 281 +KW S +AY+ DS+K + E++ ++ NG FG Sbjct: 84 KALASSQTKKWASQLQAYS-DDSEKVVSEHSGGFMLNGAFG 123