BLASTX nr result
ID: Paeonia23_contig00045528
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00045528 (213 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007297914.1| hypothetical protein MBM_10038 [Marssonina b... 79 8e-13 ref|XP_003839870.1| predicted protein [Leptosphaeria maculans JN... 61 1e-07 ref|XP_001262898.1| hypothetical protein NFIA_115880 [Neosartory... 52 2e-07 >ref|XP_007297914.1| hypothetical protein MBM_10038 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406858711|gb|EKD11810.1| hypothetical protein MBM_10038 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 288 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +2 Query: 2 SILAEARSSVPVGGIAPRAITLPERSYIPKAFIPPPKPMLA 124 SILAEARSSVPVGG+APRAITLPE SY+P+AFIPPPKPMLA Sbjct: 248 SILAEARSSVPVGGMAPRAITLPEGSYVPRAFIPPPKPMLA 288 >ref|XP_003839870.1| predicted protein [Leptosphaeria maculans JN3] gi|312216440|emb|CBX96391.1| predicted protein [Leptosphaeria maculans JN3] Length = 124 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = +1 Query: 1 QHPSRSAVLGPSRRHCTEGYNTPRKKLHSQGLYPTTETDAGLSADECTGQKP 156 QHPSR A L P H PR+++ + LYPT +TDAGL +ECTGQKP Sbjct: 72 QHPSRCADLSPGWLHVVSPIRPPRREVRDRDLYPTAQTDAGLPVEECTGQKP 123 >ref|XP_001262898.1| hypothetical protein NFIA_115880 [Neosartorya fischeri NRRL 181] gi|119411057|gb|EAW21001.1| hypothetical protein NFIA_115880 [Neosartorya fischeri NRRL 181] Length = 88 Score = 51.6 bits (122), Expect(2) = 2e-07 Identities = 31/57 (54%), Positives = 33/57 (57%) Frame = +2 Query: 2 SILAEARSSVPVGGIAPRAITLPERSYIPKAFIPPPKPMLA*AQTSAPDRSPDDHQR 172 S+ AEARSSV G IA AI P YIP AF PPKP LA Q S P R P + R Sbjct: 19 SVRAEARSSVQAGRIALPAIRCPGGHYIPGAFDRPPKPTLARPQGSTPARMPAEPWR 75 Score = 29.3 bits (64), Expect(2) = 2e-07 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 174 QVWLQALPFQQFH 212 +VW QALPFQQFH Sbjct: 76 RVWSQALPFQQFH 88