BLASTX nr result
ID: Paeonia23_contig00045150
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00045150 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274656.2| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 emb|CBI32673.3| unnamed protein product [Vitis vinifera] 59 9e-07 emb|CAN83542.1| hypothetical protein VITISV_021357 [Vitis vinifera] 59 9e-07 ref|XP_006480733.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 >ref|XP_002274656.2| PREDICTED: pentatricopeptide repeat-containing protein At5g42450, mitochondrial-like [Vitis vinifera] Length = 538 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +2 Query: 50 KGLKMVFGSSWIEIESKVHTFVTRDRKHDQNEEIYAVLG 166 K +K V GSSWIEI SKVH FVT DR HDQ++EIY VLG Sbjct: 475 KRMKGVPGSSWIEIRSKVHIFVTGDRNHDQHDEIYQVLG 513 >emb|CBI32673.3| unnamed protein product [Vitis vinifera] Length = 819 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +2 Query: 50 KGLKMVFGSSWIEIESKVHTFVTRDRKHDQNEEIYAVLG 166 K +K V GSSWIEI SKVH FVT DR HDQ++EIY VLG Sbjct: 756 KRMKGVPGSSWIEIRSKVHIFVTGDRNHDQHDEIYQVLG 794 >emb|CAN83542.1| hypothetical protein VITISV_021357 [Vitis vinifera] Length = 795 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +2 Query: 50 KGLKMVFGSSWIEIESKVHTFVTRDRKHDQNEEIYAVLG 166 K +K V GSSWIEI SKVH FVT DR HDQ++EIY VLG Sbjct: 732 KRMKGVPGSSWIEIRSKVHIFVTGDRNHDQHDEIYQVLG 770 >ref|XP_006480733.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42450, mitochondrial-like [Citrus sinensis] Length = 521 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = +2 Query: 50 KGLKMVFGSSWIEIESKVHTFVTRDRKHDQNEEIYAVL 163 KG+ V G SWIEI+SKVH FVT DR H N+EIYAVL Sbjct: 472 KGMTRVPGCSWIEIKSKVHVFVTGDRNHHMNDEIYAVL 509