BLASTX nr result
ID: Paeonia23_contig00044748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00044748 (365 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71330.1| hypothetical protein VITISV_031551 [Vitis vinifera] 65 1e-08 >emb|CAN71330.1| hypothetical protein VITISV_031551 [Vitis vinifera] Length = 1388 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = -3 Query: 363 PVEGNVYTIGYEDLKFRKRFLSEGRAGLFVLDGHKRQRIRKLTSVKERTAK 211 PV GN+Y IG EDLKF K SE R GL +DGHK++R+ KLTSVKER + Sbjct: 1335 PVAGNIYMIGAEDLKFGKSISSENRNGLINVDGHKKKRVVKLTSVKERARR 1385