BLASTX nr result
ID: Paeonia23_contig00044693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00044693 (326 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN76133.1| hypothetical protein VITISV_036298 [Vitis vinifera] 56 6e-06 >emb|CAN76133.1| hypothetical protein VITISV_036298 [Vitis vinifera] Length = 1161 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/56 (44%), Positives = 37/56 (66%) Frame = +3 Query: 159 ETSVGSEYRAMTLGTCEVMWLRFYLEELGLPQTKLTSKFCDNKAVIFLASDAFLYE 326 ++SV +EYRAM L TCE++WLR L EL + + CDN+A + +AS+ F +E Sbjct: 1045 KSSVEAEYRAMALATCELIWLRHLLRELRFGKDEQMKLICDNQAALHIASNPFFHE 1100