BLASTX nr result
ID: Paeonia23_contig00044494
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00044494 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588282.1| hypothetical protein MTR_1g005230 [Medicago ... 74 3e-11 ref|YP_007516908.1| hypothetical protein GlmaxMp59 (mitochondrio... 57 2e-06 >ref|XP_003588282.1| hypothetical protein MTR_1g005230 [Medicago truncatula] gi|355477330|gb|AES58533.1| hypothetical protein MTR_1g005230 [Medicago truncatula] Length = 96 Score = 73.6 bits (179), Expect = 3e-11 Identities = 39/69 (56%), Positives = 46/69 (66%), Gaps = 7/69 (10%) Frame = -1 Query: 187 KVRNLFTWPACIIPTPF*NTLISIST-------ESITLCLLSSYSFSLPCGGLSGVYGGS 29 ++ +L+ W + T F + I T ES+T CLLSS SFSLPCGGLSGVYGGS Sbjct: 23 RISSLYGWTEGLSQTRFNSFFAGIPTRFKFKGRESVTACLLSSNSFSLPCGGLSGVYGGS 82 Query: 28 DQSRDEEKS 2 DQSRDEEKS Sbjct: 83 DQSRDEEKS 91 >ref|YP_007516908.1| hypothetical protein GlmaxMp59 (mitochondrion) [Glycine max] gi|403311617|gb|AFR34365.1| hypothetical protein GlmaxMp59 (mitochondrion) [Glycine max] Length = 107 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 91 LLSSYSFSLPCGGLSGVYGGSDQSRDE 11 LLSSYSFSLPCGGLSGVYGGSDQSR+E Sbjct: 34 LLSSYSFSLPCGGLSGVYGGSDQSREE 60