BLASTX nr result
ID: Paeonia23_contig00044288
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00044288 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007355619.1| t-SNARE [Auricularia delicata TFB-10046 SS5]... 57 3e-06 ref|XP_001874804.1| syntaxin-like protein [Laccaria bicolor S238... 55 8e-06 >ref|XP_007355619.1| t-SNARE [Auricularia delicata TFB-10046 SS5] gi|393228624|gb|EJD36265.1| t-SNARE [Auricularia delicata TFB-10046 SS5] Length = 380 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +1 Query: 1 HAVQIEQDTEMALKDTNKAVDSARAARKKRWICFF 105 +AV I+QD +M KDT KAVDSAR ARKKRWICF+ Sbjct: 314 NAVNIDQDVQMGYKDTEKAVDSARGARKKRWICFW 348 >ref|XP_001874804.1| syntaxin-like protein [Laccaria bicolor S238N-H82] gi|164650004|gb|EDR14245.1| syntaxin-like protein [Laccaria bicolor S238N-H82] Length = 297 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +1 Query: 4 AVQIEQDTEMALKDTNKAVDSARAARKKRWICFF 105 A +E+DTE+ L+ T+KAVDSARAARKKRWICFF Sbjct: 224 AAGVEKDTEIGLQYTSKAVDSARAARKKRWICFF 257