BLASTX nr result
ID: Paeonia23_contig00042569
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00042569 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAL24466.1|AF359522_1 inward rectifying potassium channel [Vi... 59 7e-07 ref|NP_001268073.1| inward rectifying shaker-like K+ channel [Vi... 59 7e-07 emb|CAC87141.1| K+ channel protein [Populus tremula x Populus tr... 59 9e-07 gb|ABY86891.1| K+ channel protein [Populus euphratica] 55 8e-06 >gb|AAL24466.1|AF359522_1 inward rectifying potassium channel [Vitis vinifera] Length = 791 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = +3 Query: 3 ALHVAVCNGDLEMVRTLLEGGANVNKLDTRKRTPKAL 113 ALHVAVCNG LEMVR LLE GANVNK D R TPKAL Sbjct: 587 ALHVAVCNGHLEMVRILLERGANVNKKDARGWTPKAL 623 >ref|NP_001268073.1| inward rectifying shaker-like K+ channel [Vitis vinifera] gi|15824823|gb|AAL09479.1|AF359521_1 inward rectifying shaker-like K+ channel [Vitis vinifera] Length = 791 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = +3 Query: 3 ALHVAVCNGDLEMVRTLLEGGANVNKLDTRKRTPKAL 113 ALHVAVCNG LEMVR LLE GANVNK D R TPKAL Sbjct: 587 ALHVAVCNGHLEMVRILLERGANVNKKDARGWTPKAL 623 >emb|CAC87141.1| K+ channel protein [Populus tremula x Populus tremuloides] Length = 751 Score = 58.5 bits (140), Expect = 9e-07 Identities = 35/78 (44%), Positives = 47/78 (60%) Frame = +3 Query: 3 ALHVAVCNGDLEMVRTLLEGGANVNKLDTRKRTPKALFDPKQVLKDRPENSENDLQVQYM 182 ALH AVC G +EMV+ LLEGGAN+NK D R TPKAL + + S +DL + Y Sbjct: 570 ALHAAVCEGHVEMVKILLEGGANINKPDARGWTPKAL------AEQQGNKSIHDLLLNYE 623 Query: 183 YKIIIYENEDSYTIEKQT 236 + I+ E+ + IE +T Sbjct: 624 NRNILNEHRIDF-IESET 640 >gb|ABY86891.1| K+ channel protein [Populus euphratica] Length = 746 Score = 55.5 bits (132), Expect = 8e-06 Identities = 33/78 (42%), Positives = 47/78 (60%) Frame = +3 Query: 3 ALHVAVCNGDLEMVRTLLEGGANVNKLDTRKRTPKALFDPKQVLKDRPENSENDLQVQYM 182 ALH AVC G +EMV+ LL+GGA++NK D R TPKAL + + S +DL + Y Sbjct: 565 ALHAAVCEGHVEMVKILLDGGASINKPDARGWTPKAL------AEQQGNKSIHDLLLNYE 618 Query: 183 YKIIIYENEDSYTIEKQT 236 + I+ E+ + IE +T Sbjct: 619 NRNILNEHRIDF-IESET 635