BLASTX nr result
ID: Paeonia23_contig00041985
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00041985 (389 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007022417.1| Cytochrome P450 71D10, putative [Theobroma c... 60 4e-07 ref|XP_007033124.1| Cytochrome P450 71D10, putative [Theobroma c... 57 2e-06 ref|XP_007033123.1| Cytochrome P450 71D10, putative [Theobroma c... 57 2e-06 >ref|XP_007022417.1| Cytochrome P450 71D10, putative [Theobroma cacao] gi|508722045|gb|EOY13942.1| Cytochrome P450 71D10, putative [Theobroma cacao] Length = 509 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +2 Query: 2 PNEIMQEELDMTENFGLSVIRKNDLYVIPIPYHPLPVE 115 PN E+LDMTE FGLSV RKNDL++IPIPYHPLP E Sbjct: 472 PNGSKCEDLDMTECFGLSVRRKNDLFLIPIPYHPLPSE 509 >ref|XP_007033124.1| Cytochrome P450 71D10, putative [Theobroma cacao] gi|508712153|gb|EOY04050.1| Cytochrome P450 71D10, putative [Theobroma cacao] Length = 509 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +2 Query: 2 PNEIMQEELDMTENFGLSVIRKNDLYVIPIPYHPLPVE 115 PN E+LDMTE FG++V RKNDL++IPIPYHPLP E Sbjct: 472 PNGSNCEDLDMTECFGITVRRKNDLFLIPIPYHPLPSE 509 >ref|XP_007033123.1| Cytochrome P450 71D10, putative [Theobroma cacao] gi|508712152|gb|EOY04049.1| Cytochrome P450 71D10, putative [Theobroma cacao] Length = 509 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +2 Query: 2 PNEIMQEELDMTENFGLSVIRKNDLYVIPIPYHPLPVE 115 PN E+LDMTE FG++V RKNDL++IPIPYHPLP E Sbjct: 472 PNGSNCEDLDMTECFGITVRRKNDLFLIPIPYHPLPSE 509