BLASTX nr result
ID: Paeonia23_contig00041941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00041941 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007150419.1| hypothetical protein PHAVU_005G152000g [Phas... 70 3e-10 emb|CBI36646.3| unnamed protein product [Vitis vinifera] 70 3e-10 ref|XP_003632072.1| PREDICTED: probable E3 ubiquitin-protein lig... 70 3e-10 gb|EYU36735.1| hypothetical protein MIMGU_mgv1a003208mg [Mimulus... 70 4e-10 ref|XP_006347287.1| PREDICTED: probable E3 ubiquitin-protein lig... 70 4e-10 ref|XP_004241404.1| PREDICTED: probable E3 ubiquitin-protein lig... 70 4e-10 emb|CAA70322.1| unknown [Nicotiana plumbaginifolia] 70 4e-10 emb|CAA56188.1| unnamed protein product [Nicotiana tabacum] 70 4e-10 gb|EXB68665.1| putative E3 ubiquitin-protein ligase ARI7 [Morus ... 69 5e-10 ref|XP_003543557.1| PREDICTED: probable E3 ubiquitin-protein lig... 69 7e-10 gb|EXC12233.1| putative E3 ubiquitin-protein ligase ARI8 [Morus ... 69 9e-10 ref|XP_002312201.2| zinc finger family protein [Populus trichoca... 69 9e-10 ref|XP_002315117.2| zinc finger family protein [Populus trichoca... 69 9e-10 ref|XP_007029181.1| IBR domain-containing protein isoform 2 [The... 69 9e-10 ref|XP_007029180.1| IBR domain-containing protein isoform 1 [The... 69 9e-10 ref|XP_007208709.1| hypothetical protein PRUPE_ppa003187mg [Prun... 69 9e-10 ref|XP_004172081.1| PREDICTED: probable E3 ubiquitin-protein lig... 69 9e-10 ref|XP_004138892.1| PREDICTED: probable E3 ubiquitin-protein lig... 69 9e-10 ref|XP_002268068.2| PREDICTED: probable E3 ubiquitin-protein lig... 69 9e-10 emb|CBI38350.3| unnamed protein product [Vitis vinifera] 69 9e-10 >ref|XP_007150419.1| hypothetical protein PHAVU_005G152000g [Phaseolus vulgaris] gi|561023683|gb|ESW22413.1| hypothetical protein PHAVU_005G152000g [Phaseolus vulgaris] Length = 590 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +1 Query: 1 FNDFRTKLAGLTIVTRNYFENLVRALENGLSDVDS 105 FNDFRTKLAGLT VTRNYFENLVRALENGLSDVDS Sbjct: 489 FNDFRTKLAGLTSVTRNYFENLVRALENGLSDVDS 523 >emb|CBI36646.3| unnamed protein product [Vitis vinifera] Length = 516 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +1 Query: 1 FNDFRTKLAGLTIVTRNYFENLVRALENGLSDVDS 105 FNDFRTKLAGLT VTRNYFENLVRALENGLSDVDS Sbjct: 436 FNDFRTKLAGLTSVTRNYFENLVRALENGLSDVDS 470 >ref|XP_003632072.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI7-like [Vitis vinifera] gi|147800085|emb|CAN64272.1| hypothetical protein VITISV_008933 [Vitis vinifera] Length = 587 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +1 Query: 1 FNDFRTKLAGLTIVTRNYFENLVRALENGLSDVDS 105 FNDFRTKLAGLT VTRNYFENLVRALENGLSDVDS Sbjct: 485 FNDFRTKLAGLTSVTRNYFENLVRALENGLSDVDS 519 >gb|EYU36735.1| hypothetical protein MIMGU_mgv1a003208mg [Mimulus guttatus] Length = 600 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 1 FNDFRTKLAGLTIVTRNYFENLVRALENGLSDVDSE 108 FNDFRTKLAGLT VT+NYFENLVRALENGLSDVDS+ Sbjct: 499 FNDFRTKLAGLTSVTKNYFENLVRALENGLSDVDSQ 534 >ref|XP_006347287.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI7-like [Solanum tuberosum] Length = 555 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 1 FNDFRTKLAGLTIVTRNYFENLVRALENGLSDVDSE 108 FNDFRTKLAGLT VTRNYFENLVRALENGL+DVDS+ Sbjct: 490 FNDFRTKLAGLTSVTRNYFENLVRALENGLADVDSQ 525 >ref|XP_004241404.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI7-like [Solanum lycopersicum] Length = 550 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 1 FNDFRTKLAGLTIVTRNYFENLVRALENGLSDVDSE 108 FNDFRTKLAGLT VTRNYFENLVRALENGL+DVDS+ Sbjct: 485 FNDFRTKLAGLTSVTRNYFENLVRALENGLADVDSQ 520 >emb|CAA70322.1| unknown [Nicotiana plumbaginifolia] Length = 324 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 1 FNDFRTKLAGLTIVTRNYFENLVRALENGLSDVDSE 108 FNDFRTKLAGLT VTRNYFENLVRALENGL+DVDS+ Sbjct: 259 FNDFRTKLAGLTSVTRNYFENLVRALENGLADVDSQ 294 >emb|CAA56188.1| unnamed protein product [Nicotiana tabacum] Length = 117 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 1 FNDFRTKLAGLTIVTRNYFENLVRALENGLSDVDSE 108 FNDFRTKLAGLT VTRNYFENLVRALENGL+DVDS+ Sbjct: 52 FNDFRTKLAGLTSVTRNYFENLVRALENGLADVDSQ 87 >gb|EXB68665.1| putative E3 ubiquitin-protein ligase ARI7 [Morus notabilis] Length = 180 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 1 FNDFRTKLAGLTIVTRNYFENLVRALENGLSDVDSE 108 FNDFRTKLAGLT VT+NYFENLVRALENGLSDVDS+ Sbjct: 78 FNDFRTKLAGLTRVTKNYFENLVRALENGLSDVDSQ 113 >ref|XP_003543557.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI7-like [Glycine max] Length = 589 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 1 FNDFRTKLAGLTIVTRNYFENLVRALENGLSDVDS 105 FNDFRTKLAGLT VTRNYFENLVRALENGL+DVDS Sbjct: 489 FNDFRTKLAGLTSVTRNYFENLVRALENGLADVDS 523 >gb|EXC12233.1| putative E3 ubiquitin-protein ligase ARI8 [Morus notabilis] Length = 597 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 1 FNDFRTKLAGLTIVTRNYFENLVRALENGLSDVDS 105 FN+FRTKLAGLT VTRNYFENLVRALENGLSDVDS Sbjct: 495 FNEFRTKLAGLTSVTRNYFENLVRALENGLSDVDS 529 >ref|XP_002312201.2| zinc finger family protein [Populus trichocarpa] gi|550332622|gb|EEE89568.2| zinc finger family protein [Populus trichocarpa] Length = 591 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 1 FNDFRTKLAGLTIVTRNYFENLVRALENGLSDVDS 105 FN+FRTKLAGLT VTRNYFENLVRALENGLSDVDS Sbjct: 489 FNEFRTKLAGLTSVTRNYFENLVRALENGLSDVDS 523 >ref|XP_002315117.2| zinc finger family protein [Populus trichocarpa] gi|550330113|gb|EEF01288.2| zinc finger family protein [Populus trichocarpa] Length = 591 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 1 FNDFRTKLAGLTIVTRNYFENLVRALENGLSDVDS 105 FN+FRTKLAGLT VTRNYFENLVRALENGLSDVDS Sbjct: 489 FNEFRTKLAGLTSVTRNYFENLVRALENGLSDVDS 523 >ref|XP_007029181.1| IBR domain-containing protein isoform 2 [Theobroma cacao] gi|508717786|gb|EOY09683.1| IBR domain-containing protein isoform 2 [Theobroma cacao] Length = 596 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 1 FNDFRTKLAGLTIVTRNYFENLVRALENGLSDVDS 105 FN+FRTKLAGLT VTRNYFENLVRALENGLSDVDS Sbjct: 494 FNEFRTKLAGLTSVTRNYFENLVRALENGLSDVDS 528 >ref|XP_007029180.1| IBR domain-containing protein isoform 1 [Theobroma cacao] gi|508717785|gb|EOY09682.1| IBR domain-containing protein isoform 1 [Theobroma cacao] Length = 596 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 1 FNDFRTKLAGLTIVTRNYFENLVRALENGLSDVDS 105 FN+FRTKLAGLT VTRNYFENLVRALENGLSDVDS Sbjct: 494 FNEFRTKLAGLTSVTRNYFENLVRALENGLSDVDS 528 >ref|XP_007208709.1| hypothetical protein PRUPE_ppa003187mg [Prunus persica] gi|462404351|gb|EMJ09908.1| hypothetical protein PRUPE_ppa003187mg [Prunus persica] Length = 595 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 1 FNDFRTKLAGLTIVTRNYFENLVRALENGLSDVDS 105 FN+FRTKLAGLT VTRNYFENLVRALENGLSDVDS Sbjct: 493 FNEFRTKLAGLTSVTRNYFENLVRALENGLSDVDS 527 >ref|XP_004172081.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI8-like [Cucumis sativus] Length = 194 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 1 FNDFRTKLAGLTIVTRNYFENLVRALENGLSDVDS 105 FN+FRTKLAGLT VTRNYFENLVRALENGLSDVDS Sbjct: 94 FNEFRTKLAGLTSVTRNYFENLVRALENGLSDVDS 128 >ref|XP_004138892.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI8-like [Cucumis sativus] Length = 597 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 1 FNDFRTKLAGLTIVTRNYFENLVRALENGLSDVDS 105 FN+FRTKLAGLT VTRNYFENLVRALENGLSDVDS Sbjct: 497 FNEFRTKLAGLTSVTRNYFENLVRALENGLSDVDS 531 >ref|XP_002268068.2| PREDICTED: probable E3 ubiquitin-protein ligase ARI8-like [Vitis vinifera] Length = 652 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 1 FNDFRTKLAGLTIVTRNYFENLVRALENGLSDVDS 105 FN+FRTKLAGLT VTRNYFENLVRALENGLSDVDS Sbjct: 550 FNEFRTKLAGLTSVTRNYFENLVRALENGLSDVDS 584 >emb|CBI38350.3| unnamed protein product [Vitis vinifera] Length = 581 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 1 FNDFRTKLAGLTIVTRNYFENLVRALENGLSDVDS 105 FN+FRTKLAGLT VTRNYFENLVRALENGLSDVDS Sbjct: 479 FNEFRTKLAGLTSVTRNYFENLVRALENGLSDVDS 513